Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-TDP2 Polyclonal Antibody – Cat# AAA197501 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-TTRAP Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysateTDP2 is supported by BioGPS gene expression data to be expressed in HepG2)

Tyrosyl-DNA Phosphodiesterase 2 (TDP2) Antibody – Rabbit Polyclonal

TTRAP antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
TDP2; EAP2; AD022; EAPII; TTRAP; hTDP2; dJ30M3.3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
TTRAP, Antibody; TTRAP antibody - middle region; anti-TDP2 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IPPYYSYLKKRSSNYEIITGHEEGYFTAIMLKKSRVKLKSQEIIPFPSTK
Sequence Length
362
Applicable Applications for anti-TDP2 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TTRAP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-TTRAP Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysateTDP2 is supported by BioGPS gene expression data to be expressed in HepG2)

Rabbit Anti-TDP2 Polyclonal Antibody – Cat# AAA197501 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-TTRAP Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysateTDP2 is supported by BioGPS gene expression data to be expressed in HepG2)

WB (Western Blot)

(Sample Type: r-tdp2Sample: 1. DT40 (5x105cells)2. DT40 + rec. hTDP2 (5x105cells)3. soluble HIS-hTDP2 (5x105cells)4. pellet HIS-hTDP2 (5x105cells)Primary dilution:1:1000Secondary Antibody: dakocytomation Goat anti-rabbitSecondary dilution: 1:5000Image Submitted by: Keith CaldecottUniversity of Sussex )

Rabbit Anti-TDP2 Polyclonal Antibody – Cat# AAA197501 – WB (Western Blot) WB (Western Blot) (Sample Type: r-tdp2Sample: 1. DT40 (5x105cells)2. DT40 + rec. hTDP2 (5x105cells)3. soluble HIS-hTDP2 (5x105cells)4. pellet HIS-hTDP2 (5x105cells)Primary dilution:1:1000Secondary Antibody: dakocytomation Goat anti-rabbitSecondary dilution: 1:5000Image Submitted by: Keith CaldecottUniversity of Sussex )

IHC (Immunohistochemistry)

(Human kidney)

Rabbit Anti-TDP2 Polyclonal Antibody – Cat# AAA197501 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Human kidney)
Related Product Information for anti-TDP2 antibody
This is a rabbit polyclonal antibody against TTRAP. It was validated on Western Blot and immunohistochemistry

Target Description: The TTRAP gene encodes a member of a superfamily of divalent cation-dependent phosphodiesterases. The encoded protein associates with CD40, tumor necrosis factor (TNF) receptor-75 and TNF receptor associated factors (TRAFs), and inhibits nuclear factor-kappa-B activation. This protein has sequence and structural similarities with APE1 endonuclease, which is involved in both DNA repair and the activation of transcription factors.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
tyrosyl-DNA phosphodiesterase 2
NCBI Official Synonym Full Names
tyrosyl-DNA phosphodiesterase 2
NCBI Official Symbol
TDP2
NCBI Official Synonym Symbols
EAP2; AD022; EAPII; TTRAP; hTDP2; dJ30M3.3
NCBI Protein Information
tyrosyl-DNA phosphodiesterase 2
UniProt Protein Name
Tyrosyl-DNA phosphodiesterase 2
UniProt Gene Name
TDP2
UniProt Synonym Gene Names
EAP2; TTRAP; Tyr-DNA phosphodiesterase 2; hTDP2; 5'-Tyr-DNA phosphodiesterase; EAPII
UniProt Entry Name
TYDP2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The TDP2 tdp2 (Catalog #AAA197501) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TTRAP antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TTRAP can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the TDP2 tdp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IPPYYSYLKK RSSNYEIITG HEEGYFTAIM LKKSRVKLKS QEIIPFPSTK. It is sometimes possible for the material contained within the vial of "TTRAP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.