Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-TSC22D1 Polyclonal Antibody – Cat# AAA198380 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-TSC22D1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: ACHN cell lysate)

TSC22 Domain Family Protein 1 Isoform 4 (TSC22D1) Antibody – Rabbit Polyclonal

TSC22D1 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
TSC22D1; Ptg-2; TSC22; TGFB1I4
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TSC22D1, Antibody; TSC22D1 antibody - middle region; anti-TSC22D1 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Specificity
Immunogen specific to all three isotypes of TSC22D1 (110, 16, 60kD)
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ASVRLDNSSSGASVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKEQIKEL
Sequence Length
144
Applicable Applications for anti-TSC22D1 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TSC22D1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-TSC22D1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: ACHN cell lysate)

Rabbit Anti-TSC22D1 Polyclonal Antibody – Cat# AAA198380 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-TSC22D1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: ACHN cell lysate)

IHC (Immunohiostchemistry)

(Rabbit Anti-TSC22D1 antibodyFormalin Fixed Paraffin Embedded Tissue: Human TestisPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Rabbit Anti-TSC22D1 Polyclonal Antibody – Cat# AAA198380 – IHC (Immunohiostchemistry) IHC (Immunohiostchemistry) (Rabbit Anti-TSC22D1 antibodyFormalin Fixed Paraffin Embedded Tissue: Human TestisPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

IHC (Immunohistochemistry)

(Rabbit Anti-TSC22D1 antibodyFormalin Fixed Paraffin Embedded Tissue: Human ColonPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Rabbit Anti-TSC22D1 Polyclonal Antibody – Cat# AAA198380 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Rabbit Anti-TSC22D1 antibodyFormalin Fixed Paraffin Embedded Tissue: Human ColonPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)
Related Product Information for anti-TSC22D1 antibody
This is a rabbit polyclonal antibody against TSC22D1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TSC22D1 belongs to the TSC-22/Dip/Bun family. It is a transcriptional repressor. TSC22D1 acts on the C-type natriuretic peptide (CNP) promoter.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16kDa
NCBI Official Full Name
TSC22 domain family protein 1 isoform 4
NCBI Official Synonym Full Names
TSC22 domain family member 1
NCBI Official Symbol
TSC22D1
NCBI Official Synonym Symbols
Ptg-2; TSC22; TGFB1I4
NCBI Protein Information
TSC22 domain family protein 1
UniProt Protein Name
TSC22 domain family protein 1
UniProt Gene Name
TSC22D1
UniProt Synonym Gene Names
KIAA1994; TGFB1I4; TSC22
UniProt Entry Name
T22D1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The TSC22D1 tsc22d1 (Catalog #AAA198380) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TSC22D1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's TSC22D1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the TSC22D1 tsc22d1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ASVRLDNSSS GASVVAIDNK IEQAMDLVKS HLMYAVREEV EVLKEQIKEL. It is sometimes possible for the material contained within the vial of "TSC22D1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.