Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198013_WB13.jpg WB (Western Blot) (WB Suggested Anti-TRIP13 Antibody Titration: 5.0ug/mlELISA Titer: 1:12500Positive Control: Jurkat cell lysateTRIP13 is supported by BioGPS gene expression data to be expressed in Jurkat)

Rabbit TRIP13 Polyclonal Antibody | anti-TRIP13 antibody

TRIP13 antibody - N-terminal region

Gene Names
TRIP13; MVA3; 16E1BP
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
TRIP13, Antibody; TRIP13 antibody - N-terminal region; anti-TRIP13 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KDSQPIDLSACTVALHIFQLNEDGPSSENLEEETENIIAANHWVLPAAEF
Sequence Length
432
Applicable Applications for anti-TRIP13 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 79%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TRIP13
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-TRIP13 Antibody Titration: 5.0ug/mlELISA Titer: 1:12500Positive Control: Jurkat cell lysateTRIP13 is supported by BioGPS gene expression data to be expressed in Jurkat)

product-image-AAA198013_WB13.jpg WB (Western Blot) (WB Suggested Anti-TRIP13 Antibody Titration: 5.0ug/mlELISA Titer: 1:12500Positive Control: Jurkat cell lysateTRIP13 is supported by BioGPS gene expression data to be expressed in Jurkat)

IHC (Immunohistochemistry)

(Rabbit Anti-TRIP13 antibodyParaffin Embedded Tissue: Human Heart cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA198013_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-TRIP13 antibodyParaffin Embedded Tissue: Human Heart cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-TRIP13 antibody
This is a rabbit polyclonal antibody against TRIP13. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The thyroid hormone (T3) receptors (TRs) are hormone-dependent transcription factors that regulate expression of a variety of specific target genes. TRIP13 specifically interacts with the ligand binding domain of the TRs. It is a member of Trips (TR-interacting proteins) family. Nearly all of the Trips also show similar ligand-dependent interaction with the retinoid X receptor (RXR), but none interact with the glucocorticoid receptor under any conditions. Trips predict specific functional roles: one is an apparent human homolog of a yeast transcriptional coactivator, one is a new member of a class of nonhistone chromosomal proteins, and one contains a conserved domain associated with ubiquitination of specific target proteins.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49kDa
NCBI Official Full Name
pachytene checkpoint protein 2 homolog isoform 1
NCBI Official Synonym Full Names
thyroid hormone receptor interactor 13
NCBI Official Symbol
TRIP13
NCBI Official Synonym Symbols
MVA3; 16E1BP
NCBI Protein Information
pachytene checkpoint protein 2 homolog
UniProt Protein Name
Pachytene checkpoint protein 2 homolog
UniProt Gene Name
TRIP13
UniProt Synonym Gene Names
PCH2; 16E1-BP; HPV16 E1 protein-binding protein; TR-interacting protein 13; TRIP-13
UniProt Entry Name
PCH2_HUMAN

Similar Products

Product Notes

The TRIP13 trip13 (Catalog #AAA198013) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRIP13 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TRIP13 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the TRIP13 trip13 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KDSQPIDLSA CTVALHIFQL NEDGPSSENL EEETENIIAA NHWVLPAAEF. It is sometimes possible for the material contained within the vial of "TRIP13, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.