Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-TRIM35 Polyclonal Antibody – Cat# AAA198448 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-TRIM35 Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysate)

Tripartite Motif-Containing Protein 35 Isoform 1 (TRIM35) Antibody – Rabbit Polyclonal

TRIM35 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
TRIM35; HLS5; MAIR
Reactivity
Tested Reactivity: Human
Predicted Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast
Purity
Protein A purified
Synonyms
TRIM35, Antibody; TRIM35 antibody - C-terminal region; anti-TRIM35 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Tested Reactivity: Human
Predicted Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Sequence
RTQGVEGDHCVTSDPATSPLVLAIPRRLRVELECEEGELSFYDAERHCHL
Protein Size (# AA)
493 amino acids
Protein Interactions
USP49; PAN2; USP2; TRIM5; TRIM11; UBE2U; UBE2W; UBE2D4; UBE2D3; UBE2D2; UBE2D1; TSG101; UBE2K;
Blocking Peptide
For anti-TRIM35 (MBS3204468) antibody is Catalog # MBS3229435
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human TRIM35
Protein Name
Tripartite motif-containing protein 35
Predicted Homology
Based on Immunogen Sequence Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%; Yeast: 85%
Replacement Item
This antibody may replace item sc-100880 from Santa Cruz Biotechnology.
Preparation and Storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-TRIM35 Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysate)

Rabbit Anti-TRIM35 Polyclonal Antibody – Cat# AAA198448 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-TRIM35 Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-TRIM35 antibody
This is a rabbit polyclonal antibody against TRIM35. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TRIM35 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. TRIM35 may play a role as a tumor suppressor, and is implicated in the cell death mechanism
Product Categories/Family for anti-TRIM35 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57kDa
NCBI Official Full Name
tripartite motif-containing protein 35 isoform 1
NCBI Official Synonym Full Names
tripartite motif containing 35
NCBI Official Symbol
TRIM35
NCBI Official Synonym Symbols
HLS5; MAIR
NCBI Protein Information
tripartite motif-containing protein 35
UniProt Protein Name
Tripartite motif-containing protein 35
UniProt Gene Name
TRIM35
UniProt Synonym Gene Names
HLS5; KIAA1098

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The TRIM35 trim35 (Catalog #AAA198448) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRIM35 antibody - C-terminal region reacts with Tested Reactivity: Human Predicted Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: RTQGVEGDHC VTSDPATSPL VLAIPRRLRV ELECEEGELS FYDAERHCHL. It is sometimes possible for the material contained within the vial of "TRIM35, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.