Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-TRIM32 Polyclonal Antibody – Cat# AAA198417 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-TRIM32 Antibody Titration: 1.025 ug/mlPositive Control: 293T cells lysateTRIM32 is supported by BioGPS gene expression data to be expressed in HEK293T)

E3 Ubiquitin-Protein Ligase TRIM32 (TRIM32) Antibody – Rabbit Polyclonal

TRIM32 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
TRIM32; HT2A; BBS11; TATIP; LGMD2H; LGMDR8
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
TRIM32, Antibody; TRIM32 antibody - C-terminal region; anti-TRIM32 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GQLGRQISHFFSENEDFRCIAGMCVDARGDLIVADSSRKEILHFPKGGGY
Sequence Length
653
Applicable Applications for anti-TRIM32 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human TRIM32
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-TRIM32 Antibody Titration: 1.025 ug/mlPositive Control: 293T cells lysateTRIM32 is supported by BioGPS gene expression data to be expressed in HEK293T)

Rabbit Anti-TRIM32 Polyclonal Antibody – Cat# AAA198417 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-TRIM32 Antibody Titration: 1.025 ug/mlPositive Control: 293T cells lysateTRIM32 is supported by BioGPS gene expression data to be expressed in HEK293T)

WB (Western Blot)

(Host: RabbitTarget Name: TRIM32Sample Tissue: Human A549 Whole CellAntibody Dilution: 1ug/ml)

Rabbit Anti-TRIM32 Polyclonal Antibody – Cat# AAA198417 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: TRIM32Sample Tissue: Human A549 Whole CellAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Human Muscle)

Rabbit Anti-TRIM32 Polyclonal Antibody – Cat# AAA198417 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Human Muscle)
Related Product Information for anti-TRIM32 antibody
This is a rabbit polyclonal antibody against TRIM32. It was validated on Western Blot and immunohistochemistry

Target Description: TRIM32 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. TRIM32 localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes.The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes.The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes.The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
72kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase TRIM32
NCBI Official Synonym Full Names
tripartite motif containing 32
NCBI Official Symbol
TRIM32
NCBI Official Synonym Symbols
HT2A; BBS11; TATIP; LGMD2H; LGMDR8
NCBI Protein Information
E3 ubiquitin-protein ligase TRIM32
UniProt Protein Name
E3 ubiquitin-protein ligase TRIM32
UniProt Gene Name
TRIM32
UniProt Synonym Gene Names
HT2A
UniProt Entry Name
TRI32_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The TRIM32 trim32 (Catalog #AAA198417) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRIM32 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's TRIM32 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the TRIM32 trim32 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GQLGRQISHF FSENEDFRCI AGMCVDARGD LIVADSSRKE ILHFPKGGGY. It is sometimes possible for the material contained within the vial of "TRIM32, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.