Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-TP73 Polyclonal Antibody – Cat# AAA197606 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-TP73 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysate)

Tumor Protein P73 Isoform A (TP73) Antibody – Rabbit Polyclonal

TP73 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
TP73; P73
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TP73, Antibody; TP73 antibody - N-terminal region; anti-TP73 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AQSTATSPDGGTTFEHLWSSLEPDSTYFDLPQSSRGNNEVVGGTDSSMDV
Sequence Length
636
Applicable Applications for anti-TP73 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Human: 100%; Mouse: 93%; Pig: 92%; Rat: 93%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TP73
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-TP73 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysate)

Rabbit Anti-TP73 Polyclonal Antibody – Cat# AAA197606 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-TP73 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysate)

WB (Western Blot)

(WB Suggested Anti-TP73 AntibodyPositive Control: Lane1: 10ug untransfected H1299, Lane2: 10ug GFP-TAp73 transfected H1299, Lane3: 10ug GFP-DNp73 transfected H1299, Lane4: 10ug GFP-DBDp73 transfected H1299Primary Antibody Dilution : 1:1000Secondary Antibody : Anti-rabbit-HRPSecondry Antibody Dilution : 1:5000Submitted by: Francesca Grespi, VIB-Department for Molecular Biomedical Research, University of Gent)

Rabbit Anti-TP73 Polyclonal Antibody – Cat# AAA197606 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-TP73 AntibodyPositive Control: Lane1: 10ug untransfected H1299, Lane2: 10ug GFP-TAp73 transfected H1299, Lane3: 10ug GFP-DNp73 transfected H1299, Lane4: 10ug GFP-DBDp73 transfected H1299Primary Antibody Dilution : 1:1000Secondary Antibody : Anti-rabbit-HRPSecondry Antibody Dilution : 1:5000Submitted by: Francesca Grespi, VIB-Department for Molecular Biomedical Research, University of Gent)

WB (Western Blot)

(Host: RabbitTarget Name: TP73Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

Rabbit Anti-TP73 Polyclonal Antibody – Cat# AAA197606 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: TP73Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-TP73 antibody
This is a rabbit polyclonal antibody against TP73. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TP73 belongs to the p53 family. It participates in the apoptotic response to DNA damage. When overproduced, it activates transcription from p53-responsive promoters and induces apoptosis. TP53 may be a tumor suppressor protein. This gene encodes tumor protein p73, which is a member of the p53 family of transcription factors involved in cellular responses to stress and development. The family members include p53, p63, and p73 and have high sequence similarity to one another, which allows p63 and p73 to transactivate p53-responsive genes causing cell cycle arrest and apoptosis. The family members can interact with each other in many ways involving direct or indirect protein interactions, resulting in regulation of the same target gene promoters or regulation of each other's promoters. The p73 protein is expressed at very low levels in normal tissues and is differentially expressed in a number of tumors. The p73 gene expresses at least 35 mRNA variants due to the use of alternate promoters, alternate translation initiation sites, and multiple splice variations. Theoretically this can account for 29 different p73 isoforms; however, the biological validity and the full-length nature of most variants have not been determined.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
69kDa
NCBI Official Full Name
tumor protein p73 isoform a
NCBI Official Synonym Full Names
tumor protein p73
NCBI Official Symbol
TP73
NCBI Official Synonym Symbols
P73
NCBI Protein Information
tumor protein p73
UniProt Protein Name
Tumor protein p73
UniProt Gene Name
TP73
UniProt Synonym Gene Names
P73
UniProt Entry Name
P73_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The TP73 tp73 (Catalog #AAA197606) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TP73 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's TP73 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the TP73 tp73 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AQSTATSPDG GTTFEHLWSS LEPDSTYFDL PQSSRGNNEV VGGTDSSMDV. It is sometimes possible for the material contained within the vial of "TP73, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.