Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-TNK1 Polyclonal Antibody – Cat# AAA201320 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: TNK1Antibody Dilution: 1.0ug/mlSample Type: RPMI-8226 cell lysateTNK1 is supported by BioGPS gene expression data to be expressed in RPMI 8226)

Non-Receptor Tyrosine-Protein Kinase TNK1 Isoform 2 (TNK1) Antibody – Rabbit Polyclonal

TNK1 antibody - C-terminal region

Average rating 0.0
No ratings yet
Reactivity
Guinea Pig, Human, Pig, Rabbit, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TNK1, Antibody; TNK1 antibody - C-terminal region; anti-TNK1 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Guinea Pig, Human, Pig, Rabbit, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EIRQARAVPQGPPGLPPRPPLSSSSPQPSQPSRERLPWPKRKPPHNHPMG
Sequence Length
661
Applicable Applications for anti-TNK1 antibody
WB (Western Blot)
Homology
Guinea Pig: 83%; Human: 100%; Pig: 85%; Rabbit: 77%; Yeast: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: TNK1Antibody Dilution: 1.0ug/mlSample Type: RPMI-8226 cell lysateTNK1 is supported by BioGPS gene expression data to be expressed in RPMI 8226)

Rabbit Anti-TNK1 Polyclonal Antibody – Cat# AAA201320 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: TNK1Antibody Dilution: 1.0ug/mlSample Type: RPMI-8226 cell lysateTNK1 is supported by BioGPS gene expression data to be expressed in RPMI 8226)

IHC (Immunohistochemistry)

(Rabbit Anti-TNK1 antibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult Skeletal muscleObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit Anti-TNK1 Polyclonal Antibody – Cat# AAA201320 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Rabbit Anti-TNK1 antibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult Skeletal muscleObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-TNK1 antibody
This is a rabbit polyclonal antibody against TNK1. It was validated on Western Blot

Target Description: The protein encoded by this gene belongs to the tyrosine protein kinase family. Tyrosine protein kinases are important regulators of intracellular signal transduction pathways, mediating cellular proliferation, survival, and development. This gene is highly expressed in fetal tissues and at lower levels in few adult tissues, thus may function in signaling pathways utilized broadly during fetal development, and more selectively in adult tissues. It plays a negative regulatory role in the Ras-Raf1-MAPK pathway, and knockout mice have been shown to develop spontaneous tumors, suggesting a role as a tumor suppressor gene. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
72kDa
NCBI Official Full Name
non-receptor tyrosine-protein kinase TNK1 isoform 2
NCBI Official Synonym Full Names
tyrosine kinase non receptor 1
NCBI Official Symbol
TNK1
NCBI Protein Information
non-receptor tyrosine-protein kinase TNK1
UniProt Protein Name
Non-receptor tyrosine-protein kinase TNK1
UniProt Gene Name
TNK1
UniProt Entry Name
TNK1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The TNK1 tnk1 (Catalog #AAA201320) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TNK1 antibody - C-terminal region reacts with Guinea Pig, Human, Pig, Rabbit, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's TNK1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the TNK1 tnk1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EIRQARAVPQ GPPGLPPRPP LSSSSPQPSQ PSRERLPWPK RKPPHNHPMG. It is sometimes possible for the material contained within the vial of "TNK1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.