Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-TINF2 Polyclonal Antibody – Cat# AAA200803 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-TINF2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: MCF7 cell lysateTINF2 is supported by BioGPS gene expression data to be expressed in MCF7)

TERF1-Interacting Nuclear Factor 2 Isoform 1 (TINF2) Antibody – Rabbit Polyclonal

TINF2 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
TINF2; TIN2; DKCA3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TINF2, Antibody; TINF2 antibody - middle region; anti-TINF2 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SDEEENGQGEGKESLENYQKTKFDTLIPTLCEYLPPSGHGAIPVSSCDCR
Sequence Length
451
Applicable Applications for anti-TINF2 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 86%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 92%; Pig: 100%; Rat: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TINF2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-TINF2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: MCF7 cell lysateTINF2 is supported by BioGPS gene expression data to be expressed in MCF7)

Rabbit Anti-TINF2 Polyclonal Antibody – Cat# AAA200803 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-TINF2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: MCF7 cell lysateTINF2 is supported by BioGPS gene expression data to be expressed in MCF7)

WB (Western Blot)

(Host: RabbitTarget Name: TINF2Sample Type: MCF7Antibody Dilution: 1.0ug/mlTINF2 is supported by BioGPS gene expression data to be expressed in MCF7)

Rabbit Anti-TINF2 Polyclonal Antibody – Cat# AAA200803 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: TINF2Sample Type: MCF7Antibody Dilution: 1.0ug/mlTINF2 is supported by BioGPS gene expression data to be expressed in MCF7)
Related Product Information for anti-TINF2 antibody
This is a rabbit polyclonal antibody against TINF2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TINF2 is a component of the shelterin complex (telosome) that is involved in the regulation of telomere length and protection. Shelterin associates with arrays of double-stranded TTAGGG repeats added by telomerase and protects chromosome ends; without its protective activity, telomeres are no longer hidden from the DNA damage surveillance and chromosome ends are inappropriately processed by DNA repair pathways. It plays a role in shelterin complex assembly.
Product Categories/Family for anti-TINF2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50kDa
NCBI Official Full Name
TERF1-interacting nuclear factor 2 isoform 1
NCBI Official Synonym Full Names
TERF1 interacting nuclear factor 2
NCBI Official Symbol
TINF2
NCBI Official Synonym Symbols
TIN2; DKCA3
NCBI Protein Information
TERF1-interacting nuclear factor 2
UniProt Protein Name
TERF1-interacting nuclear factor 2
UniProt Gene Name
TINF2
UniProt Synonym Gene Names
TIN2
UniProt Entry Name
TINF2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The TINF2 tinf2 (Catalog #AAA200803) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TINF2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TINF2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the TINF2 tinf2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SDEEENGQGE GKESLENYQK TKFDTLIPTL CEYLPPSGHG AIPVSSCDCR. It is sometimes possible for the material contained within the vial of "TINF2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.