Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA108350_IHC13.jpg IHC (Immunohiostchemistry) (Tetraspanin 5 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X)

Rabbit Tetraspanin 5 Polyclonal Antibody | anti-TSPAN5 antibody

Tetraspanin 5 antibody

Average rating 0.0
No ratings yet
Gene Names
TSPAN5; NET4; NET-4; TM4SF9; TSPAN-5
Applications
Immunohistochemistry, Western Blot
Purity
Affinity purified
Synonyms
Tetraspanin 5, Antibody; Tetraspanin 5 antibody; Polyclonal Tetraspanin 5; Anti-Tetraspanin 5; TSPAN5; Tetraspanin 5; Tetraspanin -5; TM4SF9; NET-4; TSPAN-5; anti-TSPAN5 antibody
Ordering
Host
Rabbit
Clonality
Polyclonal
Specificity
Tetraspanin 5 antibody was raised against the middle region of TSPAN5
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TSPAN5 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
268
Applicable Applications for anti-TSPAN5 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Biological Significance
TSPAN5 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility.
Cross-Reactivity
Human, Mouse, Rat, Dog
Immunogen
Tetraspanin 5 antibody was raised using the middle region of TSPAN5 corresponding to a region with amino acids ASRERCGVPFSCCTKDPAEDVINTQCGYDARQKPEVDQQIVIYTKGCVPQ
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

IHC (Immunohiostchemistry)

(Tetraspanin 5 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X)

product-image-AAA108350_IHC13.jpg IHC (Immunohiostchemistry) (Tetraspanin 5 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X)

WB (Western Blot)

(Tetraspanin 5 antibody (AAA108350) used at 0.25 ug/ml to detect target protein.)

product-image-AAA108350_WB15.jpg WB (Western Blot) (Tetraspanin 5 antibody (AAA108350) used at 0.25 ug/ml to detect target protein.)
Related Product Information for anti-TSPAN5 antibody
Rabbit polyclonal Tetraspanin 5 antibody raised against the middle region of TSPAN5
Product Categories/Family for anti-TSPAN5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
30 kDa (MW of target protein)
NCBI Official Full Name
tetraspanin 5
NCBI Official Synonym Full Names
tetraspanin 5
NCBI Official Symbol
TSPAN5
NCBI Official Synonym Symbols
NET4; NET-4; TM4SF9; TSPAN-5
NCBI Protein Information
tetraspanin-5
UniProt Protein Name
Tetraspanin-5
UniProt Gene Name
TSPAN5
UniProt Synonym Gene Names
TM4SF9; Tspan-5
UniProt Entry Name
TSN5_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The TSPAN5 tspan5 (Catalog #AAA108350) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Tetraspanin 5 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the TSPAN5 tspan5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Tetraspanin 5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.