Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-TEAD4 Polyclonal Antibody – Cat# AAA198275 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-TEAD4 antibody Titration: 1 ug/mLSample Type: Human heart)

Transcriptional Enhancer Factor TEF-3 (TEAD4) Antibody – Rabbit Polyclonal

TEAD4 Antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
TEAD4; TEF3; RTEF1; TEF-3; EFTR-2; TEFR-1; TCF13L1; hRTEF-1B
Reactivity
Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
TEAD4, Antibody; TEAD4 Antibody - N-terminal region; anti-TEAD4 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TAGTITSNEWSSPTSPEGSTASGGSQALDKPIDNDAEGVWSPDIEQSFQE
Sequence Length
391
Applicable Applications for anti-TEAD4 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Guinea Pig: 83%; Horse: 92%; Human: 100%; Mouse: 92%; Pig: 92%; Rabbit: 92%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human TEAD4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-TEAD4 antibody Titration: 1 ug/mLSample Type: Human heart)

Rabbit Anti-TEAD4 Polyclonal Antibody – Cat# AAA198275 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-TEAD4 antibody Titration: 1 ug/mLSample Type: Human heart)

WB (Western Blot)

(Host: RabbitTarget Name: TEAD4Sample Type: Thyroid Tumor lysatesAntibody Dilution: 1.0ug/ml)

Rabbit Anti-TEAD4 Polyclonal Antibody – Cat# AAA198275 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: TEAD4Sample Type: Thyroid Tumor lysatesAntibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-TEAD4 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult liverObserved Staining: Nuclear in endothelial cells not in hepatocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

Rabbit Anti-TEAD4 Polyclonal Antibody – Cat# AAA198275 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Rabbit Anti-TEAD4 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult liverObserved Staining: Nuclear in endothelial cells not in hepatocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)
Related Product Information for anti-TEAD4 antibody
This is a rabbit polyclonal antibody against TEAD4. It was validated on Western Blot

Target Description: TEAD4 is a member of the transcriptional enhancer factor (TEF) family of transcription factors, which contain the TEA/ATTS DNA-binding domain. TEAD4 is preferentially expressed in the skeletal muscle, and binds to the M-CAT regulatory element found in promoters of muscle-specific genes to direct their gene expression. Alternatively spliced transcripts encoding distinct isoforms, some of which are translated through the use of a non-AUG (UUG) initiation codon, have been described for this protein.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
Transcriptional enhancer factor TEF-3
NCBI Official Synonym Full Names
TEA domain transcription factor 4
NCBI Official Symbol
TEAD4
NCBI Official Synonym Symbols
TEF3; RTEF1; TEF-3; EFTR-2; TEFR-1; TCF13L1; hRTEF-1B
NCBI Protein Information
transcriptional enhancer factor TEF-3
UniProt Protein Name
Transcriptional enhancer factor TEF-3
UniProt Gene Name
TEAD4
UniProt Synonym Gene Names
RTEF1; TCF13L1; TEF3; TEAD-4
UniProt Entry Name
TEAD4_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The TEAD4 tead4 (Catalog #AAA198275) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TEAD4 Antibody - N-terminal region reacts with Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TEAD4 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the TEAD4 tead4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TAGTITSNEW SSPTSPEGST ASGGSQALDK PIDNDAEGVW SPDIEQSFQE. It is sometimes possible for the material contained within the vial of "TEAD4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.