Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA28264_ChIP8.jpg ChIP (Chromatin Immunoprecipitation) (Chromatin immunoprecipitation analysis extracts of HeLa cell line, using TEAD1 rabbit polyclonal antibody and rabbit IgG. The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.)

Rabbit anti-Human, Mouse TEAD1 Polyclonal Antibody | anti-TEAD1 antibody

TEAD1 Polyclonal Antibody

Gene Names
TEAD1; AA; REF1; TCF13; TEF-1; NTEF-1; TCF-13; TEAD-1
Reactivity
Human, Mouse
Applications
Western Blot, Immunohistochemistry, Immunofluorescence, Chromatin Immunoprecipitation, Immunoprecipitation
Purity
Affinity Purification
Synonyms
TEAD1, Antibody; TEAD1 Polyclonal Antibody; AA; NTEF-1; REF1; TCF-13; TCF13; TEAD-1; TEF-1; anti-TEAD1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.05% proclin300,50% glycerol,pH7.3.
Sequence
AIHNKLGLPGIPRPTFPGAPGFWPGMIQTGQPGSSQDVKPFVQQAYPIQPAVTAPIPGFEPASAPAPSVPAWQGRSIGTTK
Sequence Length
426
Applicable Applications for anti-TEAD1 antibody
Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF), Chromatin Immunoprecipitation (ChIP)
Application Notes
WB: 1:500 - 1:2000
IHC: 1:50 - 1:200
IF: 1:50 - 1:200
ChIP: 1:20 - 1:50
Immunogen
Recombinant protein of human TEAD1
Immunogen Species
Human
Cellular Location
Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

ChIP (Chromatin Immunoprecipitation)

(Chromatin immunoprecipitation analysis extracts of HeLa cell line, using TEAD1 rabbit polyclonal antibody and rabbit IgG. The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.)

product-image-AAA28264_ChIP8.jpg ChIP (Chromatin Immunoprecipitation) (Chromatin immunoprecipitation analysis extracts of HeLa cell line, using TEAD1 rabbit polyclonal antibody and rabbit IgG. The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded mouse lung using TEAD1 antibody at dilution of 1:100 (40x lens).)

product-image-AAA28264_IHC7.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded mouse lung using TEAD1 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistchemistry)

(Immunohistochemistry of paraffin-embedded human gastric cancer using TEAD1 antibody at dilution of 1:100 (40x lens).)

product-image-AAA28264_IHC6.jpg IHC (Immunohistchemistry) (Immunohistochemistry of paraffin-embedded human gastric cancer using TEAD1 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human esophageal cancer using TEAD1 antibody at dilution of 1:100 (40x lens).)

product-image-AAA28264_IHC5.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human esophageal cancer using TEAD1 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human colon carcinoma using TEAD1 antibody at dilution of 1:100 (40x lens).)

product-image-AAA28264_IHC4.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human colon carcinoma using TEAD1 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human liver cancer using TEAD1 antibody at dilution of 1:100 (40x lens).)

product-image-AAA28264_IHC3.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human liver cancer using TEAD1 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human lung cancer using TEAD1 antibody at dilution of 1:100 (40x lens).)

product-image-AAA28264_IHC2.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human lung cancer using TEAD1 antibody at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using TEAD1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 120s.)

product-image-AAA28264_WB.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using TEAD1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 120s.)
Related Product Information for anti-TEAD1 antibody
This gene encodes a ubiquitous transcriptional enhancer factor that is a member of the TEA/ATTS domain family. This protein directs the transactivation of a wide variety of genes and, in placental cells, also acts as a transcriptional repressor. Mutations in this gene cause Sveinsson's chorioretinal atrophy. Additional transcript variants have been described but their full-length natures have not been experimentally verified.
Product Categories/Family for anti-TEAD1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 40kDa; 47kDa
Observed: 48kDa
NCBI Official Full Name
transcriptional enhancer factor TEF-1
NCBI Official Synonym Full Names
TEA domain transcription factor 1
NCBI Official Symbol
TEAD1
NCBI Official Synonym Symbols
AA; REF1; TCF13; TEF-1; NTEF-1; TCF-13; TEAD-1
NCBI Protein Information
transcriptional enhancer factor TEF-1
UniProt Protein Name
Transcriptional enhancer factor TEF-1
UniProt Gene Name
TEAD1
UniProt Synonym Gene Names
TCF13; TEF1; TEAD-1; TCF-13

Similar Products

Product Notes

The TEAD1 tead1 (Catalog #AAA28264) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TEAD1 Polyclonal Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's TEAD1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF), Chromatin Immunoprecipitation (ChIP). WB: 1:500 - 1:2000 IHC: 1:50 - 1:200 IF: 1:50 - 1:200 ChIP: 1:20 - 1:50. Researchers should empirically determine the suitability of the TEAD1 tead1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: AIHNKLGLPG IPRPTFPGAP GFWPGMIQTG QPGSSQDVKP FVQQAYPIQP AVTAPIPGFE PASAPAPSVP AWQGRSIGTT K. It is sometimes possible for the material contained within the vial of "TEAD1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.