Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-TBRG4 Polyclonal Antibody – Cat# AAA201144 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-TBRG4 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)

FAST Kinase Domain-Containing Protein 4 Isoform 1 (TBRG4) Antibody – Rabbit Polyclonal

TBRG4 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
TBRG4; CPR2; FASTKD4
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TBRG4, Antibody; TBRG4 antibody - N-terminal region; anti-TBRG4 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ATSPISHLPGSLMEPVEKERASTPYIEKQVDHLIKKATRPEELLELLGGS
Sequence Length
631
Applicable Applications for anti-TBRG4 antibody
WB (Western Blot)
Homology
Human: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-TBRG4 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)

Rabbit Anti-TBRG4 Polyclonal Antibody – Cat# AAA201144 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-TBRG4 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)

WB (Western Blot)

(Host: RabbitTarget Name: TBRG4Sample Type: Human HelaAntibody Dilution: 1.0ug/mlTBRG4 is supported by BioGPS gene expression data to be expressed in HeLa)

Rabbit Anti-TBRG4 Polyclonal Antibody – Cat# AAA201144 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: TBRG4Sample Type: Human HelaAntibody Dilution: 1.0ug/mlTBRG4 is supported by BioGPS gene expression data to be expressed in HeLa)
Related Product Information for anti-TBRG4 antibody
This is a rabbit polyclonal antibody against TBRG4. It was validated on Western Blot

Target Description: TBRG4 may play a role in cell cycle progression.
Product Categories/Family for anti-TBRG4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
69kDa
NCBI Official Full Name
FAST kinase domain-containing protein 4 isoform 1
NCBI Official Synonym Full Names
transforming growth factor beta regulator 4
NCBI Official Symbol
TBRG4
NCBI Official Synonym Symbols
CPR2; FASTKD4
NCBI Protein Information
FAST kinase domain-containing protein 4
UniProt Protein Name
Protein TBRG4
UniProt Gene Name
TBRG4
UniProt Synonym Gene Names
CPR2; FASTKD4; KIAA0948; Cell cycle progression protein 2
UniProt Entry Name
TBRG4_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The TBRG4 tbrg4 (Catalog #AAA201144) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TBRG4 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TBRG4 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the TBRG4 tbrg4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ATSPISHLPG SLMEPVEKER ASTPYIEKQV DHLIKKATRP EELLELLGGS. It is sometimes possible for the material contained within the vial of "TBRG4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.