Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-TBC1D4 Polyclonal Antibody – Cat# AAA201242 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-TBC1D4 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole Cell)

TBC1 Domain Family Member 4 Isoform 1 (TBC1D4) Antibody – Rabbit Polyclonal

TBC1D4 Antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
TBC1D4; AS160; NIDDM5
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TBC1D4, Antibody; TBC1D4 Antibody - C-terminal region; anti-TBC1D4 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EMEKIITQVFEMDISKQLHAYEVEYHVLQDELQESSYSCEDSETLEKLER
Sequence Length
1298
Applicable Applications for anti-TBC1D4 antibody
WB (Western Blot)
Homology
Cow: 79%; Dog: 79%; Guinea Pig: 79%; Horse: 79%; Human: 100%; Mouse: 79%; Rabbit: 83%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human TBC1D4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-TBC1D4 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole Cell)

Rabbit Anti-TBC1D4 Polyclonal Antibody – Cat# AAA201242 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-TBC1D4 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole Cell)

IHC (Immunohistochemistry)

(Rabbit Anti-TBC1D4 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult ThyroidObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit Anti-TBC1D4 Polyclonal Antibody – Cat# AAA201242 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Rabbit Anti-TBC1D4 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult ThyroidObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-TBC1D4 antibody
This is a rabbit polyclonal antibody against TBC1D4. It was validated on Western Blot

Target Description: TBC1D4 may act as a GTPase-activating protein for RAB2A, RAB8A, RAB10 and RAB14. Isoform 2 promotes insulin-induced glucose transporter SLC2A4/GLUT4 translocation at the plasma membrane, thus increasing glucose uptake.
Product Categories/Family for anti-TBC1D4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
146kDa
NCBI Official Full Name
TBC1 domain family member 4 isoform 1
NCBI Official Synonym Full Names
TBC1 domain family member 4
NCBI Official Symbol
TBC1D4
NCBI Official Synonym Symbols
AS160; NIDDM5
NCBI Protein Information
TBC1 domain family member 4
UniProt Protein Name
TBC1 domain family member 4
UniProt Gene Name
TBC1D4
UniProt Synonym Gene Names
AS160; KIAA0603; AS160
UniProt Entry Name
TBCD4_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The TBC1D4 tbc1d4 (Catalog #AAA201242) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TBC1D4 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TBC1D4 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the TBC1D4 tbc1d4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EMEKIITQVF EMDISKQLHA YEVEYHVLQD ELQESSYSCE DSETLEKLER. It is sometimes possible for the material contained within the vial of "TBC1D4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.