Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197373_WB10.jpg WB (Western Blot) (WB Suggested Anti-TAF1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Daudi cell lysateTAF1 is strongly supported by BioGPS gene expression data to be expressed in Human Daudi cells)

Rabbit TAF1 Polyclonal Antibody | anti-TAF1 antibody

TAF1 antibody - C-terminal region

Gene Names
TAF1; OF; XDP; BA2R; CCG1; CCGS; DYT3; KAT4; P250; NSCL2; TAF2A; MRXS33; N-TAF1; TAFII250; DYT3/TAF1; TAFII-250; TAF(II)250
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Chromatin Immunoprecipitation, Immunoprecipitation, Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
TAF1, Antibody; TAF1 antibody - C-terminal region; anti-TAF1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YEVSEEEEDEEEEEQRSGPSVLSQVHLSEDEEDSEDFHSIAGDSDLDSDE
Sequence Length
1872
Applicable Applications for anti-TAF1 antibody
ChIP (Chromatin immunoprecipitation), WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human TAF1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-TAF1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Daudi cell lysateTAF1 is strongly supported by BioGPS gene expression data to be expressed in Human Daudi cells)

product-image-AAA197373_WB10.jpg WB (Western Blot) (WB Suggested Anti-TAF1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Daudi cell lysateTAF1 is strongly supported by BioGPS gene expression data to be expressed in Human Daudi cells)

WB (Western Blot)

(Host: MouseTarget Name: TAF1Sample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

product-image-AAA197373_WB11.jpg WB (Western Blot) (Host: MouseTarget Name: TAF1Sample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

IHC (Immunohiostchemistry)

(Human kidney)

product-image-AAA197373_IHC13.jpg IHC (Immunohiostchemistry) (Human kidney)

ChIP (Chromatin Immunoprecipitation)

(Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.)

product-image-AAA197373_CHIP15.jpg ChIP (Chromatin Immunoprecipitation) (Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.)
Related Product Information for anti-TAF1 antibody
This is a rabbit polyclonal antibody against TAF1. It was validated on Western Blot and immunohistochemistry

Target Description: Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is the basal transcription factor TFIID, which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. TAF1 encodes the largest subunit of TFIID. This subunit binds to core promoter sequences encompassing the transcription start site. It also binds to activators and other transcriptional regulators, and these interactions affect the rate of transcription initiation. This subunit contains two independent protein kinase domains at the N and C-terminals, but also possesses acetyltransferase activity and can act as a ubiquitin-activating/conjugating enzyme.Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is the basal transcription factor TFIID, which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes the largest subunit of TFIID. This subunit binds to core promoter sequences encompassing the transcription start site. It also binds to activators and other transcriptional regulators, and these interactions affect the rate of transcription initiation. This subunit contains two independent protein kinase domains at the N and C-terminals, but also possesses acetyltransferase activity and can act as a ubiquitin-activating/conjugating enzyme. Two transcripts encoding different isoforms have been identified for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
215kDa
NCBI Official Full Name
transcription initiation factor TFIID subunit 1 isoform 2
NCBI Official Synonym Full Names
TATA-box binding protein associated factor 1
NCBI Official Symbol
TAF1
NCBI Official Synonym Symbols
OF; XDP; BA2R; CCG1; CCGS; DYT3; KAT4; P250; NSCL2; TAF2A; MRXS33; N-TAF1; TAFII250; DYT3/TAF1; TAFII-250; TAF(II)250
NCBI Protein Information
transcription initiation factor TFIID subunit 1
UniProt Protein Name
Transcription initiation factor TFIID subunit 1
UniProt Gene Name
TAF1
UniProt Synonym Gene Names
BA2R; CCG1; CCGS; TAF2A; p250; TAF(II)250; TAFII-250; TAFII250
UniProt Entry Name
TAF1_HUMAN

Similar Products

Product Notes

The TAF1 taf1 (Catalog #AAA197373) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TAF1 antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TAF1 can be used in a range of immunoassay formats including, but not limited to, ChIP (Chromatin immunoprecipitation), WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the TAF1 taf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YEVSEEEEDE EEEEQRSGPS VLSQVHLSED EEDSEDFHSI AGDSDLDSDE. It is sometimes possible for the material contained within the vial of "TAF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.