Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-STOML2 Polyclonal Antibody – Cat# AAA201116 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-STOML2 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole CellSTOML2 is supported by BioGPS gene expression data to be expressed in 721_B)

Stomatin-Like Protein 2, Mitochondrial Isoform A (STOML2) Antibody – Rabbit Polyclonal

STOML2 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
STOML2; SLP-2; HSPC108
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
STOML2, Antibody; STOML2 antibody - C-terminal region; anti-STOML2 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VTSMVAQAMGVYGALTKAPVPGTPDSLSSGSSRDVQGTDASLDEELDRVK
Sequence Length
356
Applicable Applications for anti-STOML2 antibody
WB (Western Blot)
Homology
Cow: 86%; Dog: 100%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Pig: 100%; Rabbit: 92%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-STOML2 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole CellSTOML2 is supported by BioGPS gene expression data to be expressed in 721_B)

Rabbit Anti-STOML2 Polyclonal Antibody – Cat# AAA201116 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-STOML2 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole CellSTOML2 is supported by BioGPS gene expression data to be expressed in 721_B)

WB (Western Blot)

(Host: RabbitTarget Name: STOML2Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

Rabbit Anti-STOML2 Polyclonal Antibody – Cat# AAA201116 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: STOML2Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: STOML2Sample Type: Human 293TAntibody Dilution: 1.0ug/mlSTOML2 is supported by BioGPS gene expression data to be expressed in HEK293T)

Rabbit Anti-STOML2 Polyclonal Antibody – Cat# AAA201116 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: STOML2Sample Type: Human 293TAntibody Dilution: 1.0ug/mlSTOML2 is supported by BioGPS gene expression data to be expressed in HEK293T)
Related Product Information for anti-STOML2 antibody
This is a rabbit polyclonal antibody against STOML2. It was validated on Western Blot

Target Description: The function of this protein remains unknown.
Product Categories/Family for anti-STOML2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
stomatin-like protein 2, mitochondrial isoform a
NCBI Official Synonym Full Names
stomatin like 2
NCBI Official Symbol
STOML2
NCBI Official Synonym Symbols
SLP-2; HSPC108
NCBI Protein Information
stomatin-like protein 2, mitochondrial
UniProt Protein Name
Stomatin-like protein 2, mitochondrial
UniProt Gene Name
STOML2
UniProt Synonym Gene Names
SLP2; SLP-2; Paratarg-7
UniProt Entry Name
STML2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The STOML2 stoml2 (Catalog #AAA201116) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The STOML2 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's STOML2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the STOML2 stoml2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VTSMVAQAMG VYGALTKAPV PGTPDSLSSG SSRDVQGTDA SLDEELDRVK. It is sometimes possible for the material contained within the vial of "STOML2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.