Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-STAT5B Polyclonal Antibody – Cat# AAA198425 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-STAT5B Antibody Titration: 1 ug/mlPositive Control: 293T cells lysateThere is BioGPS gene expression data showing that STAT5B is expressed in HEK293T)

Signal Transducer And Activator Of Transcription 5B (STAT5B) Antibody – Rabbit Polyclonal

STAT5B antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
STAT5B; STAT5
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
STAT5B, Antibody; STAT5B antibody - N-terminal region; anti-STAT5B antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSVDLDNP
Sequence Length
787
Applicable Applications for anti-STAT5B antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 93%; Dog: 100%; Goat: 86%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 86%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human STAT5B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-STAT5B Antibody Titration: 1 ug/mlPositive Control: 293T cells lysateThere is BioGPS gene expression data showing that STAT5B is expressed in HEK293T)

Rabbit Anti-STAT5B Polyclonal Antibody – Cat# AAA198425 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-STAT5B Antibody Titration: 1 ug/mlPositive Control: 293T cells lysateThere is BioGPS gene expression data showing that STAT5B is expressed in HEK293T)

IHC (Immunohistochemisry)

(Rabbit Anti-STAT5B AntibodyParaffin Embedded Tissue: Human TestisAntibody Concentration: 5 ug/ml)

Rabbit Anti-STAT5B Polyclonal Antibody – Cat# AAA198425 – IHC (Immunohistochemisry) IHC (Immunohistochemisry) (Rabbit Anti-STAT5B AntibodyParaffin Embedded Tissue: Human TestisAntibody Concentration: 5 ug/ml)

IHC (Immunohiostchemistry)

(Sample Type: Human prostateAnti-STAT5B antibody IHC staining of human prostate. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)

Rabbit Anti-STAT5B Polyclonal Antibody – Cat# AAA198425 – IHC (Immunohiostchemistry) IHC (Immunohiostchemistry) (Sample Type: Human prostateAnti-STAT5B antibody IHC staining of human prostate. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)

IHC (Immunohistochemistry)

(Sample Type: Human prostateAnti-STAT5B antibody IHC staining of human placenta. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)

Rabbit Anti-STAT5B Polyclonal Antibody – Cat# AAA198425 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Sample Type: Human prostateAnti-STAT5B antibody IHC staining of human placenta. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)
Related Product Information for anti-STAT5B antibody
This is a rabbit polyclonal antibody against STAT5B. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The protein is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein mediates the signal transduction triggered by various cell ligands, such as IL2, IL4, CSF1, and different growth hormones. It has been shown to be involved in diverse biological processes, such as TCR signaling, apoptosis, adult mammary gland development, and sexual dimorphism of liver gene expression. The dysregulation of the signaling pathways mediated by this protein may be the cause of the APLL.The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein mediates the signal transduction triggered by various cell ligands, such as IL2, IL4, CSF1, and different growth hormones. It has been shown to be involved in diverse biological processes, such as TCR signaling, apoptosis, adult mammary gland development, and sexual dimorphism of liver gene expression. This gene was found to fuse to retinoic acid receptor-alpha (RARA) gene in a small subset of acute promyelocytic leukemias (APLL). The dysregulation of the signaling pathways mediated by this protein may be the cause of the APLL. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
90kDa
NCBI Official Full Name
signal transducer and activator of transcription 5B
NCBI Official Synonym Full Names
signal transducer and activator of transcription 5B
NCBI Official Symbol
STAT5B
NCBI Official Synonym Symbols
STAT5
NCBI Protein Information
signal transducer and activator of transcription 5B
UniProt Protein Name
Signal transducer and activator of transcription 5B
UniProt Gene Name
STAT5B
UniProt Entry Name
STA5B_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The STAT5B stat5b (Catalog #AAA198425) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The STAT5B antibody - N-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's STAT5B can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the STAT5B stat5b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AVWIQAQQLQ GEALHQMQAL YGQHFPIEVR HYLSQWIESQ AWDSVDLDNP. It is sometimes possible for the material contained within the vial of "STAT5B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.