Steroidogenic Acute Regulatory Protein, Mitochondrial (STAR) Antibody – Rabbit Polyclonal
STAR Antibody - N-terminal region
Gene Names
STAR; STARD1
Reactivity
Tested Species Reactivity: HumanPredicted Species Reactivity: Human, Rabbit
Applications
Western Blot
Purity
Affinity purified
Synonyms
STAR, Antibody; STAR Antibody - N-terminal region; anti-STAR antibody
Product Overview
Host
Rabbit
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human, Rabbit
Predicted Species Reactivity: Human, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: KLCAGSSYRHMRNMKGLRQQAVMAISQELNRRALGGPTPSTWINQVRRRS
Sequence Length
285
Applicable Applications for anti-STAR antibody
WB (Western Blot)
Protein Size (#AA)
285 amino acids
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human STAR
Blocking Peptide
For anti-STAR (MBS3223061) antibody is
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-STAR antibody
The protein encoded by this gene plays a key role in the acute regulation of steroid hormone synthesis by enhancing the conversion of cholesterol into pregnenolone. This protein permits the cleavage of cholesterol into pregnenolone by mediating the transport of cholesterol from the outer mitochondrial membrane to the inner mitochondrial membrane. Mutations in this gene are a cause of congenital lipoid adrenal hyperplasia (CLAH), also called lipoid CAH. A pseudogene of this gene is located on chromosome 13.
Product Categories/Family for anti-STAR antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32 kDa
NCBI Official Full Name
steroidogenic acute regulatory protein, mitochondrial
NCBI Official Synonym Full Names
steroidogenic acute regulatory protein
NCBI Official Symbol
STAR
NCBI Official Synonym Symbols
STARD1
NCBI Protein Information
steroidogenic acute regulatory protein, mitochondrial
UniProt Protein Name
Steroidogenic acute regulatory protein, mitochondrial
UniProt Gene Name
STAR
UniProt Synonym Gene Names
STARD1; StAR; StARD1
UniProt Entry Name
STAR_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Additional Details
Product Notes
The STAR star (Catalog #AAA201619) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The STAR Antibody - N-terminal region reacts with Tested Species Reactivity: Human Predicted Species Reactivity: Human, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's STAR can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the STAR star for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KLCAGSSYRH MRNMKGLRQQ AVMAISQELN RRALGGPTPS TWINQVRRRS. It is sometimes possible for the material contained within the vial of "STAR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
