Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201159_WB13.jpg WB (Western Blot) (WB Suggested Anti-STAM AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole CellSTAM is supported by BioGPS gene expression data to be expressed in HeLa)

Rabbit STAM Polyclonal Antibody | anti-STAM antibody

STAM antibody - N-terminal region

Gene Names
STAM; STAM1; STAM-1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
STAM, Antibody; STAM antibody - N-terminal region; anti-STAM antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EQAKASPALVAKDPGTVANKKEEEDLAKAIELSLKEQRQQSTTLSTLYPS
Sequence Length
540
Applicable Applications for anti-STAM antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 82%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-STAM AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole CellSTAM is supported by BioGPS gene expression data to be expressed in HeLa)

product-image-AAA201159_WB13.jpg WB (Western Blot) (WB Suggested Anti-STAM AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole CellSTAM is supported by BioGPS gene expression data to be expressed in HeLa)

WB (Western Blot)

(WB Suggested Anti-STAM AntibodyPositive Control: Lane 1: 20ug mouse brain extract Lane 2: 20ug mouse brain extractPrimary Antibody Dilution : 1:500Secondary Antibody : Anti rabbit-HRPSecondry Antibody Dilution : 1:5,000Submitted by: Scott Wilson, University of Alabama at Birmingham)

product-image-AAA201159_WB15.jpg WB (Western Blot) (WB Suggested Anti-STAM AntibodyPositive Control: Lane 1: 20ug mouse brain extract Lane 2: 20ug mouse brain extractPrimary Antibody Dilution : 1:500Secondary Antibody : Anti rabbit-HRPSecondry Antibody Dilution : 1:5,000Submitted by: Scott Wilson, University of Alabama at Birmingham)
Related Product Information for anti-STAM antibody
This is a rabbit polyclonal antibody against STAM. It was validated on Western Blot

Target Description: This gene encodes a member of the signal-transducing adaptor molecule family. These proteins mediate downstream signaling of cytokine receptors and also play a role in ER to Golgi trafficking by interacting with the coat protein II complex. The encoded protein also associates with hepatocyte growth factor-regulated substrate to form the endosomal sorting complex required for transport-0 (ESCRT-0), which sorts ubiquitinated membrane proteins to the ESCRT-1 complex for lysosomal degradation. Alternatively spliced transcript variants have been observed for this gene.
Product Categories/Family for anti-STAM antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59kDa
NCBI Official Full Name
signal transducing adapter molecule 1 isoform a
NCBI Official Synonym Full Names
signal transducing adaptor molecule
NCBI Official Symbol
STAM
NCBI Official Synonym Symbols
STAM1; STAM-1
NCBI Protein Information
signal transducing adapter molecule 1
UniProt Protein Name
Signal transducing adapter molecule 1
UniProt Gene Name
STAM
UniProt Synonym Gene Names
STAM1; STAM-1
UniProt Entry Name
STAM1_HUMAN

Similar Products

Product Notes

The STAM stam (Catalog #AAA201159) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The STAM antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's STAM can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the STAM stam for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EQAKASPALV AKDPGTVANK KEEEDLAKAI ELSLKEQRQQ STTLSTLYPS. It is sometimes possible for the material contained within the vial of "STAM, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.