Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-ST14 Polyclonal Antibody – Cat# AAA199854 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-ST14 Antibody Titration: 0.25ug/mlPositive Control: DLD1 cell lysateST14 is strongly supported by BioGPS gene expression data to be expressed in Human DLD1 cells)

ST14 Protein, Partial (ST14) Antibody – Rabbit Polyclonal

ST14 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
ST14; HAI; MTSP1; SNC19; ARCI11; MT-SP1; PRSS14; TADG15; TMPRSS14
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
ST14, Antibody; ST14 antibody - C-terminal region; anti-ST14 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVINQTTCENLLPQQIT
Sequence Length
855
Applicable Applications for anti-ST14 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human ST14
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-ST14 Antibody Titration: 0.25ug/mlPositive Control: DLD1 cell lysateST14 is strongly supported by BioGPS gene expression data to be expressed in Human DLD1 cells)

Rabbit Anti-ST14 Polyclonal Antibody – Cat# AAA199854 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-ST14 Antibody Titration: 0.25ug/mlPositive Control: DLD1 cell lysateST14 is strongly supported by BioGPS gene expression data to be expressed in Human DLD1 cells)

IHC (Immunohistochemistry)

(Human kidney)

Rabbit Anti-ST14 Polyclonal Antibody – Cat# AAA199854 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Human kidney)
Related Product Information for anti-ST14 antibody
This is a rabbit polyclonal antibody against ST14. It was validated on Western Blot and immunohistochemistry

Target Description: ST14 is an epithelial-derived, integral membrane serine protease. This protease forms a complex with the Kunitz-type serine protease inhibitor, HAI-1, and is found to be activated by sphingosine 1-phosphate. This protease has been shown to cleave and activate hepatocyte growth factor/scattering factor, and urokinase plasminogen activator, which suggest the function of this protease as an epithelial membrane activator for other proteases and latent growth factors. The expression of this protease has been associated with breast, colon, prostate, and ovarian tumors, which implicates its role in cancer invasion, and metastasis.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
95kDa
NCBI Official Full Name
ST14 protein, partial
NCBI Official Synonym Full Names
suppression of tumorigenicity 14
NCBI Official Symbol
ST14
NCBI Official Synonym Symbols
HAI; MTSP1; SNC19; ARCI11; MT-SP1; PRSS14; TADG15; TMPRSS14
NCBI Protein Information
suppressor of tumorigenicity 14 protein
UniProt Protein Name
Suppressor of tumorigenicity 14 protein
UniProt Gene Name
ST14
UniProt Synonym Gene Names
PRSS14; SNC19; TADG15; MT-SP1
UniProt Entry Name
ST14_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The ST14 st14 (Catalog #AAA199854) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ST14 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ST14 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the ST14 st14 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SHVFPAGKAI WVTGWGHTQY GGTGALILQK GEIRVINQTT CENLLPQQIT. It is sometimes possible for the material contained within the vial of "ST14, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.