Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201777_WB13.jpg WB (Western Blot) (WB Suggested Anti-SRF Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysateSRF is supported by BioGPS gene expression data to be expressed in Jurkat)

Rabbit SRF Polyclonal Antibody | anti-SRF antibody

SRF antibody - N-terminal region

Gene Names
SRF; MCM1
Reactivity
Cow, Dog, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot, Chromatin Immunoprecipitation, Immunoprecipitation
Purity
Protein A purified
Synonyms
SRF, Antibody; SRF antibody - N-terminal region; anti-SRF antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ATGGYGPVSGAVSGAKPGKKTRGRVKIKMEFIDNKLRRYTTFSKRKTGIM
Sequence Length
508
Applicable Applications for anti-SRF antibody
WB (Western Blot), ChIP (Chromatin immunoprecipitation)
Homology
Cow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SRF
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-SRF Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysateSRF is supported by BioGPS gene expression data to be expressed in Jurkat)

product-image-AAA201777_WB13.jpg WB (Western Blot) (WB Suggested Anti-SRF Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysateSRF is supported by BioGPS gene expression data to be expressed in Jurkat)

ChIP (Chromatin Immunoprecipitation)

(Chromatin Immunoprecipitation (ChIP) Using SRF antibody - N-terminal region and HCT116 Cells)

product-image-AAA201777_CHIP15.jpg ChIP (Chromatin Immunoprecipitation) (Chromatin Immunoprecipitation (ChIP) Using SRF antibody - N-terminal region and HCT116 Cells)
Related Product Information for anti-SRF antibody
This is a rabbit polyclonal antibody against SRF. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SRF is a ubiquitous nuclear protein that stimulates both cell proliferation and differentiation. It is a member of the MADS (MCM1, Agamous, Deficiens, and SRF) box superfamily of transcription factors. This protein binds to the serum response element (SRE) in the promoter region of target genes. This protein regulates the activity of many immediate-early genes, for example c-fos, and thereby participates in cell cycle regulation, apoptosis, cell growth, and cell differentiation. This gene is the downstream target of many pathways; for example, the mitogen-activated protein kinase pathway (MAPK) that acts through the ternary complex factors (TCFs).

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52kDa
NCBI Official Full Name
serum response factor isoform 1
NCBI Official Synonym Full Names
serum response factor
NCBI Official Symbol
SRF
NCBI Official Synonym Symbols
MCM1
NCBI Protein Information
serum response factor
UniProt Protein Name
Serum response factor
UniProt Gene Name
SRF
UniProt Synonym Gene Names
SRF
UniProt Entry Name
SRF_HUMAN

Similar Products

Product Notes

The SRF srf (Catalog #AAA201777) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SRF antibody - N-terminal region reacts with Cow, Dog, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SRF can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), ChIP (Chromatin immunoprecipitation). Researchers should empirically determine the suitability of the SRF srf for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ATGGYGPVSG AVSGAKPGKK TRGRVKIKME FIDNKLRRYT TFSKRKTGIM. It is sometimes possible for the material contained within the vial of "SRF, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.