Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-SREBF1 Polyclonal Antibody – Cat# AAA198168 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-SREBF1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: SP2/0 cell lysate)

Sterol Regulatory Element-Binding Protein 1 Isoform A (SREBF1) Antibody – Rabbit Polyclonal

SREBF1 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
Srebf1; ADD1; SREBP1; bHLHd1
Reactivity
Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SREBF1, Antibody; SREBF1 antibody - N-terminal region; anti-SREBF1 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DIEDMLQLINNQDSDFPGLFDAPYAGGETGDTGPSSPGANSPESFSSASL
Sequence Length
1134
Applicable Applications for anti-SREBF1 antibody
WB (Western Blot)
Homology
Mouse: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of mouse SREBF1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-SREBF1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: SP2/0 cell lysate)

Rabbit Anti-SREBF1 Polyclonal Antibody – Cat# AAA198168 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-SREBF1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: SP2/0 cell lysate)

WB (Western Blot)

(WB Suggested Anti-SREBF1 AntibodyPositive Control: Lane 1: 50ug mouse glomerular endothelial lysate Lane 2: 50ug mouse glomerular endothelial lysatePrimary Antibody Dilution : 1:1000Secondary Antibody : Anti-rabbit-HRPSecondry Antibody Dilution : 1:5000Submitted by: Xiaoxin Wang, UC Denver)

Rabbit Anti-SREBF1 Polyclonal Antibody – Cat# AAA198168 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-SREBF1 AntibodyPositive Control: Lane 1: 50ug mouse glomerular endothelial lysate Lane 2: 50ug mouse glomerular endothelial lysatePrimary Antibody Dilution : 1:1000Secondary Antibody : Anti-rabbit-HRPSecondry Antibody Dilution : 1:5000Submitted by: Xiaoxin Wang, UC Denver)
Related Product Information for anti-SREBF1 antibody
This is a rabbit polyclonal antibody against SREBF1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Srebf1 is transcriptional activator that binds to the sterol regulatory element 1 (SRE-1) (5'-ATCACCCCAC-3'). Srebf1 also binds to an E-box motif (5'-ATCACGTGA-3'). Srebf1 regulates the transcription of genes for sterol biosynthesis and the LDL receptor gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
125kDa
NCBI Official Full Name
sterol regulatory element-binding protein 1 isoform a
NCBI Official Synonym Full Names
sterol regulatory element binding transcription factor 1
NCBI Official Symbol
Srebf1
NCBI Official Synonym Symbols
ADD1; SREBP1; bHLHd1
NCBI Protein Information
sterol regulatory element-binding protein 1
UniProt Protein Name
Sterol regulatory element-binding protein 1
UniProt Gene Name
Srebf1
UniProt Synonym Gene Names
Srebp1; SREBP-1
UniProt Entry Name
SRBP1_MOUSE

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The SREBF1 srebf1 (Catalog #AAA198168) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SREBF1 antibody - N-terminal region reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SREBF1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the SREBF1 srebf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DIEDMLQLIN NQDSDFPGLF DAPYAGGETG DTGPSSPGAN SPESFSSASL. It is sometimes possible for the material contained within the vial of "SREBF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.