Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-SNAPC2 Polyclonal Antibody – Cat# AAA201798 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-SNAPC2 Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysate)

Snrna-Activating Protein Complex Subunit 2 (SNAPC2) Antibody – Rabbit Polyclonal

SNAPC2 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
SNAPC2; SNAP45; PTFDELTA
Reactivity
Human
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
SNAPC2, Antibody; SNAPC2 antibody - middle region; anti-SNAPC2 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: STEEDFAVDFEKIYKYLSSVSRSGRSPELSAAESAVVLDLLMSLPEELPL
Sequence Length
334
Applicable Applications for anti-SNAPC2 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SNAPC2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-SNAPC2 Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysate)

Rabbit Anti-SNAPC2 Polyclonal Antibody – Cat# AAA201798 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-SNAPC2 Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysate)

IHC (Immunohistochemistry)

(Immunohistochemistry with Human kidney lysate tissue)

Rabbit Anti-SNAPC2 Polyclonal Antibody – Cat# AAA201798 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Immunohistochemistry with Human kidney lysate tissue)
Related Product Information for anti-SNAPC2 antibody
This is a rabbit polyclonal antibody against SNAPC2. It was validated on Western Blot and immunohistochemistry

Target Description: SNAPc is involved in transcription by two types of polymerases; it is required for transcription of both the RNA polymerase II and III small-nuclear RNA genes and binds specifically to the proximal sequence element PSE, a non-TATA-box basal promoter element common to these two types of genes. In addition, SNAPc is composed of at least three TAFs, SNAP43, SNAP45 and SNAP50.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
snRNA-activating protein complex subunit 2
NCBI Official Synonym Full Names
small nuclear RNA activating complex polypeptide 2
NCBI Official Symbol
SNAPC2
NCBI Official Synonym Symbols
SNAP45; PTFDELTA
NCBI Protein Information
snRNA-activating protein complex subunit 2
UniProt Protein Name
snRNA-activating protein complex subunit 2
UniProt Gene Name
SNAPC2
UniProt Synonym Gene Names
SNAP45; SNAPc subunit 2; PSE-binding factor subunit delta; PTF subunit delta; SNAPc 45 kDa subunit
UniProt Entry Name
SNPC2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The SNAPC2 snapc2 (Catalog #AAA201798) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SNAPC2 antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SNAPC2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the SNAPC2 snapc2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: STEEDFAVDF EKIYKYLSSV SRSGRSPELS AAESAVVLDL LMSLPEELPL. It is sometimes possible for the material contained within the vial of "SNAPC2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.