Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-SNAI2 Polyclonal Antibody – Cat# AAA197561 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-SNAI2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Transfected 293T)

Zinc Finger Protein SNAI2 (SNAI2) Antibody – Rabbit Polyclonal

SNAI2 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
SNAI2; SLUG; WS2D; SLUGH; SLUGH1; SNAIL2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
SNAI2, Antibody; SNAI2 antibody - middle region; anti-SNAI2 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SDTSSKDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTFS
Sequence Length
268
Applicable Applications for anti-SNAI2 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Yeast: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SNAI2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-SNAI2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Transfected 293T)

Rabbit Anti-SNAI2 Polyclonal Antibody – Cat# AAA197561 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-SNAI2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Transfected 293T)

WB (Western Blot)

(Host: RabbitTarget Name: SNAI2Sample Tissue: Human JurkatAntibody Dilution: 1.0ug/ml)

Rabbit Anti-SNAI2 Polyclonal Antibody – Cat# AAA197561 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: SNAI2Sample Tissue: Human JurkatAntibody Dilution: 1.0ug/ml)

IHC (Immunohiostchemistry)

(Testis)

Rabbit Anti-SNAI2 Polyclonal Antibody – Cat# AAA197561 – IHC (Immunohiostchemistry) IHC (Immunohiostchemistry) (Testis)

IHC (Immunohistochemistry)

(Human kidney)

Rabbit Anti-SNAI2 Polyclonal Antibody – Cat# AAA197561 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Human kidney)
Related Product Information for anti-SNAI2 antibody
This is a rabbit polyclonal antibody against SNAI2. It was validated on Western Blot and immunohistochemistry

Target Description: SNAI2 is a member of the Snail family of C2H2-type zinc finger transcription factors. The protein acts as a transcriptional repressor that binds to E-box motifs and is also likely to repress E-cadherin transcription in breast carcinoma. This protein is involved in epithelial-mesenchymal transitions and has antiapoptotic activity. Mutations in this gene may be associated with sporatic cases of neural tube defects. This gene encodes a member of the Snail family of C2H2-type zinc finger transcription factors. The encoded protein acts as a transcriptional repressor that binds to E-box motifs and is also likely to repress E-cadherin transcription in breast carcinoma. This protein is involved in epithelial-mesenchymal transitions and has antiapoptotic activity. Mutations in this gene may be associated with sporatic cases of neural tube defects. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30kDa
NCBI Official Full Name
zinc finger protein SNAI2
NCBI Official Synonym Full Names
snail family transcriptional repressor 2
NCBI Official Symbol
SNAI2
NCBI Official Synonym Symbols
SLUG; WS2D; SLUGH; SLUGH1; SNAIL2
NCBI Protein Information
zinc finger protein SNAI2
UniProt Protein Name
Zinc finger protein SNAI2
UniProt Gene Name
SNAI2
UniProt Synonym Gene Names
SLUG; SLUGH
UniProt Entry Name
SNAI2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The SNAI2 snai2 (Catalog #AAA197561) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SNAI2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's SNAI2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the SNAI2 snai2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SDTSSKDHSG SESPISDEEE RLQSKLSDPH AIEAEKFQCN LCNKTYSTFS. It is sometimes possible for the material contained within the vial of "SNAI2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.