Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Mouse Anti-SMNDC1 Polyclonal Antibody – Cat# AAA14799 – WB (Western Blot) WB (Western Blot) (SMNDC1 polyclonal antibody. Western Blot analysis of SMNDC1 expression in PC-12.)

Survival Of Motor Neuron-Related-Splicing Factor 30 (SMNDC1) Antibody – Mouse Polyclonal

SMNDC1 (Survival Motor Neuron Domain-containing Protein 1, 30 kDa Splicing Factor SMNrp, SMN-related Protein, SMNR, Survival of Motor Neuron-related-splicing Factor 30, SPF30)

Average rating 0.0
No ratings yet
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
SMNDC1, Antibody; SMNDC1 (Survival Motor Neuron Domain-containing Protein 1, 30 kDa Splicing Factor SMNrp, SMN-related Protein, SMNR, Survival of Motor Neuron-related-splicing Factor 30, SPF30); Anti -SMNDC1 (Survival Motor Neuron Domain-containing Protein 1, 30 kDa Splicing Factor SMNrp, SMN-related Protein, SMNR, Survival of Motor Neuron-related-splicing Factor 30, SPF30); anti-SMNDC1 antibody
Ordering

Product Overview

Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SMNDC1. Species Crossreactivity: mouse and rat.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MSEDLAKQLASYKAQLQQVEAALSGNGENEDLLKLKKDLQEVIELTKDLLSTQPSETLASSDSFASTQPTHSWKVGDKCMAVWSEDGQCYEAEIEEIDEENGTAAITFAGYGNAEVTPLLNLKPVEEGRKAKEDSGNKPMSKKEMIAQQREYKKKKALKKAQRIKELEQEREDQKVKWQQFNNRAYSKNKKGQVKRSIFASPESVTGKVGVGTCGIADKPMTQYQDTSKYNVRHLMPQ
Applicable Applications for anti-SMNDC1 antibody
WB (Western Blot), IF (Immunofluorescence)
Application Notes
Suitable for use in Immunofluorescence and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Full-length human SMNDC1, aa1-238 (NP_005862.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(SMNDC1 polyclonal antibody. Western Blot analysis of SMNDC1 expression in PC-12.)

Mouse Anti-SMNDC1 Polyclonal Antibody – Cat# AAA14799 – WB (Western Blot) WB (Western Blot) (SMNDC1 polyclonal antibody. Western Blot analysis of SMNDC1 expression in PC-12.)

WB (Western Blot)

(SMNDC1 polyclonal antibody. Western Blot analysis of SMNDC1 expression in human placenta.)

Mouse Anti-SMNDC1 Polyclonal Antibody – Cat# AAA14799 – WB (Western Blot) WB (Western Blot) (SMNDC1 polyclonal antibody. Western Blot analysis of SMNDC1 expression in human placenta.)

IF (Immunofluorescence)

(Immunofluorescence of purified antibody to SMNDC1 on HeLa cell. [antibody concentration 10ug/ml])

Mouse Anti-SMNDC1 Polyclonal Antibody – Cat# AAA14799 – IF (Immunofluorescence) IF (Immunofluorescence) (Immunofluorescence of purified antibody to SMNDC1 on HeLa cell. [antibody concentration 10ug/ml])

WB (Western Blot)

(Western Blot analysis of SMNDC1 expression in transfected 293T cell line by SMNDC1 polyclonal antibody. Lane 1: SMNDC1 transfected lysate (26.18kD). Lane 2: Non-transfected lysate.)

Mouse Anti-SMNDC1 Polyclonal Antibody – Cat# AAA14799 – WB (Western Blot) WB (Western Blot) (Western Blot analysis of SMNDC1 expression in transfected 293T cell line by SMNDC1 polyclonal antibody. Lane 1: SMNDC1 transfected lysate (26.18kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(SMNDC1 polyclonal antibody. Western Blot analysis of SMNDC1 expression in NIH/3T3.)

Mouse Anti-SMNDC1 Polyclonal Antibody – Cat# AAA14799 – WB (Western Blot) WB (Western Blot) (SMNDC1 polyclonal antibody. Western Blot analysis of SMNDC1 expression in NIH/3T3.)

WB (Western Blot)

(SMNDC1 polyclonal antibody. Western Blot analysis of SMNDC1 expression in A-431.)

Mouse Anti-SMNDC1 Polyclonal Antibody – Cat# AAA14799 – WB (Western Blot) WB (Western Blot) (SMNDC1 polyclonal antibody. Western Blot analysis of SMNDC1 expression in A-431.)

WB (Western Blot)

(SMNDC1 polyclonal antibody. Western Blot analysis of SMNDC1 expression in Raw 264.7.)

Mouse Anti-SMNDC1 Polyclonal Antibody – Cat# AAA14799 – WB (Western Blot) WB (Western Blot) (SMNDC1 polyclonal antibody. Western Blot analysis of SMNDC1 expression in Raw 264.7.)
Product Categories/Family for anti-SMNDC1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
survival of motor neuron-related-splicing factor 30
NCBI Official Symbol
SMNDC1
NCBI Protein Information
survival of motor neuron-related-splicing factor 30

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The SMNDC1 (Catalog #AAA14799) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SMNDC1 (Survival Motor Neuron Domain-containing Protein 1, 30 kDa Splicing Factor SMNrp, SMN-related Protein, SMNR, Survival of Motor Neuron-related-splicing Factor 30, SPF30) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SMNDC1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IF (Immunofluorescence). Suitable for use in Immunofluorescence and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the SMNDC1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSEDLAKQLA SYKAQLQQVE AALSGNGENE DLLKLKKDLQ EVIELTKDLL STQPSETLAS SDSFASTQPT HSWKVGDKCM AVWSEDGQCY EAEIEEIDEE NGTAAITFAG YGNAEVTPLL NLKPVEEGRK AKEDSGNKPM SKKEMIAQQR EYKKKKALKK AQRIKELEQE REDQKVKWQQ FNNRAYSKNK KGQVKRSIFA SPESVTGKVG VGTCGIADKP MTQYQDTSKY NVRHLMPQ. It is sometimes possible for the material contained within the vial of "SMNDC1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.