Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-SMC1A Polyclonal Antibody – Cat# AAA198389 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-SMC1A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 293T cell lysateSMC1A is supported by BioGPS gene expression data to be expressed in HEK293T)

Structural Maintenance Of Chromosomes Protein 1A Isoform 1 (SMC1A) Antibody – Rabbit Polyclonal

SMC1A antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
SMC1A; SMC1; SMCB; CDLS2; SB1.8; SMC1L1; DXS423E; SMC1alpha
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
SMC1A, Antibody; SMC1A antibody - C-terminal region; anti-SMC1A antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VISLKEEFYTKAESLIGVYPEQGDCVISKVLTFDLTKYPDANPNPNEQ
Sequence Length
1233
Applicable Applications for anti-SMC1A antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human SMC1A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-SMC1A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 293T cell lysateSMC1A is supported by BioGPS gene expression data to be expressed in HEK293T)

Rabbit Anti-SMC1A Polyclonal Antibody – Cat# AAA198389 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-SMC1A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 293T cell lysateSMC1A is supported by BioGPS gene expression data to be expressed in HEK293T)

WB (Western Blot)

(Host: RabbitTarget Name: SMC1ASample Type: Human JurkatAntibody Dilution: 1.0ug/mlSMC1A is supported by BioGPS gene expression data to be expressed in Jurkat)

Rabbit Anti-SMC1A Polyclonal Antibody – Cat# AAA198389 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: SMC1ASample Type: Human JurkatAntibody Dilution: 1.0ug/mlSMC1A is supported by BioGPS gene expression data to be expressed in Jurkat)

WB (Western Blot)

(Host: RabbitTarget Name: SMC1ASample Type: Human HepG2Antibody Dilution: 1.0ug/mlSMC1A is supported by BioGPS gene expression data to be expressed in HepG2)

Rabbit Anti-SMC1A Polyclonal Antibody – Cat# AAA198389 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: SMC1ASample Type: Human HepG2Antibody Dilution: 1.0ug/mlSMC1A is supported by BioGPS gene expression data to be expressed in HepG2)

IHC (Immunohistochemistry)

(Rabbit Anti-SMC1A AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit Anti-SMC1A Polyclonal Antibody – Cat# AAA198389 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Rabbit Anti-SMC1A AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-SMC1A antibody
This is a rabbit polyclonal antibody against SMC1A. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The cohesin multiprotein complex is required for sister chromatid cohesion. This complex is composed partly of two structural maintenance of chromosomes (SMC) proteins, SMC3 and either SMC1L2 or the protein encoded by SMC1A gene. Most of the cohesin complexes dissociate from the chromosomes before mitosis, although those complexes at the kinetochore remain. Therefore, the SMC1A protein is thought to be an important part of functional kinetochores. In addition, this protein interacts with BRCA1 and is phosphorylated by ATM, indicating a potential role for this protein in DNA repair. Proper cohesion of sister chromatids is a prerequisite for the correct segregation of chromosomes during cell division. The cohesin multiprotein complex is required for sister chromatid cohesion. This complex is composed partly of two structural maintenance of chromosomes (SMC) proteins, SMC3 and either SMC1L2 or the protein encoded by this gene. Most of the cohesin complexes dissociate from the chromosomes before mitosis, although those complexes at the kinetochore remain. Therefore, the encoded protein is thought to be an important part of functional kinetochores. In addition, this protein interacts with BRCA1 and is phosphorylated by ATM, indicating a potential role for this protein in DNA repair. This gene, which belongs to the SMC gene family, is located in an area of the X-chromosome that escapes X inactivation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
143kDa
NCBI Official Full Name
structural maintenance of chromosomes protein 1A isoform 1
NCBI Official Synonym Full Names
structural maintenance of chromosomes 1A
NCBI Official Symbol
SMC1A
NCBI Official Synonym Symbols
SMC1; SMCB; CDLS2; SB1.8; SMC1L1; DXS423E; SMC1alpha
NCBI Protein Information
structural maintenance of chromosomes protein 1A
UniProt Protein Name
Structural maintenance of chromosomes protein 1A
UniProt Gene Name
SMC1A
UniProt Synonym Gene Names
DXS423E; KIAA0178; SB1.8; SMC1; SMC1L1; SMC protein 1A; SMC-1-alpha; SMC-1A
UniProt Entry Name
SMC1A_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The SMC1A smc1a (Catalog #AAA198389) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SMC1A antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SMC1A can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the SMC1A smc1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VISLKEEFYT KAESLIGVYP EQGDCVISKV LTFDLTKYPD ANPNPNEQ. It is sometimes possible for the material contained within the vial of "SMC1A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.