Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-SLC7A7 Polyclonal Antibody – Cat# AAA199334 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-SLC7A7 Antibody Titration: 0.2-1 ug/mlPositive Control: PANC1 cell lysate)

Y+L Amino Acid Transporter 1 (SLC7A7) Antibody – Rabbit Polyclonal

SLC7A7 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
SLC7A7; LPI; LAT3; MOP-2; Y+LAT1; y+LAT-1
Reactivity
Tested Reactivity: Human
Predicted Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Purity
Affinity Purified
Synonyms
SLC7A7, Antibody; SLC7A7 antibody - middle region; anti-SLC7A7 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Tested Reactivity: Human
Predicted Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Sequence
WGTLVQDIFTYAKVLALIAVIVAGIVRLGQGASTHFENSFEGSSFAVGDI
Protein Size (# AA)
511 amino acids
Blocking Peptide
For anti-SLC7A7 (MBS3207072) antibody is Catalog # MBS3232038
Protein Interactions
NEDD4L; SLC3A2;
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SLC7A7
Predicted Homology
Cow: 100%; Dog: 86%; Guinea Pig: 79%; Horse: 100%; Human: 100%; Mouse: 79%; Pig: 93%; Rabbit: 100%; Rat: 79%
Replacement Item
This antibody may replace item sc-34553 from Santa Cruz Biotechnology.
Preparation and Storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-SLC7A7 Antibody Titration: 0.2-1 ug/mlPositive Control: PANC1 cell lysate)

Rabbit Anti-SLC7A7 Polyclonal Antibody – Cat# AAA199334 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-SLC7A7 Antibody Titration: 0.2-1 ug/mlPositive Control: PANC1 cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: SLC7A7Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Rabbit Anti-SLC7A7 Polyclonal Antibody – Cat# AAA199334 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: SLC7A7Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: SLC7A7Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

Rabbit Anti-SLC7A7 Polyclonal Antibody – Cat# AAA199334 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: SLC7A7Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-SLC7A7 antibodyFormalin Fixed Paraffin Embedded Tissue: Human KidneyPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Rabbit Anti-SLC7A7 Polyclonal Antibody – Cat# AAA199334 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Rabbit Anti-SLC7A7 antibodyFormalin Fixed Paraffin Embedded Tissue: Human KidneyPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)
Related Product Information for anti-SLC7A7 antibody
The protein encoded by this gene is the light subunit of a cationic amino acid transporter. This sodium-independent transporter is formed when the light subunit encoded by this gene dimerizes with the heavy subunit transporter protein SLC3A2. This transporter is found in epithelial cell membranes where it transfers cationic and large neutral amino acids from the cell to the extracellular space. Defects in this gene are a cause of lysinuric protein intolerance (LPI). Several transcript variants encoding the same protein have been found for this gene.
Product Categories/Family for anti-SLC7A7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Synonym Full Names
solute carrier family 7 member 7
NCBI Official Symbol
SLC7A7
NCBI Official Synonym Symbols
LPI; LAT3; MOP-2; Y+LAT1; y+LAT-1
NCBI Protein Information
Y+L amino acid transporter 1
UniProt Protein Name
Y+L amino acid transporter 1
UniProt Gene Name
SLC7A7
UniProt Synonym Gene Names
MOP-2; Y+LAT1; y+LAT-1

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The SLC7A7 slc7a7 (Catalog #AAA199334) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC7A7 antibody - middle region reacts with Tested Reactivity: Human Predicted Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: WGTLVQDIFT YAKVLALIAV IVAGIVRLGQ GASTHFENSF EGSSFAVGDI. It is sometimes possible for the material contained within the vial of "SLC7A7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.