Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-SLC7A1 Polyclonal Antibody – Cat# AAA199326 – Application Data Application Data (25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. The 68 kDa and 66 kDa isoforms contain the peptide sequence and the protein may be glycosylated.)

High Affinity Cationic Amino Acid Transporter 1 (SLC7A1) Antibody – Rabbit Polyclonal

SLC7A1 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
SLC7A1; ERR; ATRC1; CAT-1; HCAT1; REC1L
Reactivity
Tested Reactivity: Human
Predicted Reactivity Human, Cow, Horse, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SLC7A1, Antibody; SLC7A1 antibody - N-terminal region; anti-SLC7A1 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Tested Reactivity: Human
Predicted Reactivity Human, Cow, Horse, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/mL (varies by lot)
Sequence
LGFIMVSGFVKGSVKNWQLTEEDFGNTSGRLCLNNDTKEGKPGVGGFMPF
Applicable Applications for anti-SLC7A1 antibody
WB (Western Blot)
Protein Size (# AA)
629 amino acids
Protein Interactions
FATE1; UBC; BAG3; APP; ELAVL1;
Blocking Peptide
For anti-SLC7A1 (MBS3207058) antibody is Catalog #
Replacement Item
This antibody may replace item sc-293226 from Santa Cruz Biotechnology.
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC7A1
Predicted Homology
Cow: 100%; Horse: 93%; Human: 100%; Pig: 86%; Rabbit: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Application Data

(25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. The 68 kDa and 66 kDa isoforms contain the peptide sequence and the protein may be glycosylated.)

Rabbit Anti-SLC7A1 Polyclonal Antibody – Cat# AAA199326 – Application Data Application Data (25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. The 68 kDa and 66 kDa isoforms contain the peptide sequence and the protein may be glycosylated.)

WB (Western Blot)

(WB Suggested Anti-SLC7A1 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateSLC7A1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.)

Rabbit Anti-SLC7A1 Polyclonal Antibody – Cat# AAA199326 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-SLC7A1 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateSLC7A1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.)
Related Product Information for anti-SLC7A1 antibody
Description of Target: SLC7A1 is a high-affinity, low capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine) in non-hepatic tissues. It may also function as an ecotropic retroviral leukemia receptor.
Product Categories/Family for anti-SLC7A1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
68kDa
NCBI Official Full Name
high affinity cationic amino acid transporter 1
NCBI Official Synonym Full Names
solute carrier family 7 member 1
NCBI Official Symbol
SLC7A1
NCBI Official Synonym Symbols
ERR; ATRC1; CAT-1; HCAT1; REC1L
NCBI Protein Information
high affinity cationic amino acid transporter 1
UniProt Protein Name
High affinity cationic amino acid transporter 1
UniProt Gene Name
SLC7A1
UniProt Synonym Gene Names
ATRC1; ERR; REC1L; CAT-1; CAT1; ERR
UniProt Entry Name
CTR1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The SLC7A1 slc7a1 (Catalog #AAA199326) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC7A1 antibody - N-terminal region reacts with Tested Reactivity: Human Predicted Reactivity Human, Cow, Horse, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's SLC7A1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the SLC7A1 slc7a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LGFIMVSGFV KGSVKNWQLT EEDFGNTSGR LCLNNDTKEG KPGVGGFMPF. It is sometimes possible for the material contained within the vial of "SLC7A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.