Sodium-Dependent Phosphate Transport Protein 2A Isoform 2 (SLC34A1) Antibody – Rabbit Polyclonal
SLC34A1 Antibody - N-terminal region
Gene Names
SLC34A1; NPT2; FRTS2; SLC11; HCINF2; NAPI-3; NPTIIa; NPHLOP1; SLC17A2
Reactivity
Tested: RatPredicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SLC34A1, Antibody; SLC34A1 Antibody - N-terminal region; anti-SLC34A1 antibody
Product Overview
Host
Rabbit
Reactivity
Tested: Rat
Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Sheep
Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YVPSPQVLHRIPGTTTYAISSLSPVALTEHSCPYGEVLECHDPLPAKLAQ
Sequence Length
337
Applicable Applications for anti-SLC34A1 antibody
WB (Western Blot)
Protein Size (# AA)
337 amino acids
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 92%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of rat SLC34A1
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-SLC34A1 antibody
This is a rabbit polyclonal antibody against Slc34a1. It was validated on Western Blot
Target Description: This gene encodes a member of the type II sodium-phosphate cotransporter family. Mutations in this gene are associated with hypophosphatemia nephrolithiasis/osteoporosis 1. Alternative splicing results in multiple transcript variants.
Target Description: This gene encodes a member of the type II sodium-phosphate cotransporter family. Mutations in this gene are associated with hypophosphatemia nephrolithiasis/osteoporosis 1. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-SLC34A1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
sodium-dependent phosphate transport protein 2A isoform 2
NCBI Official Synonym Full Names
solute carrier family 34 member 1
NCBI Official Symbol
SLC34A1
NCBI Official Synonym Symbols
NPT2; FRTS2; SLC11; HCINF2; NAPI-3; NPTIIa; NPHLOP1; SLC17A2
NCBI Protein Information
sodium-dependent phosphate transport protein 2A
UniProt Protein Name
Sodium-dependent phosphate transport protein 2A
UniProt Gene Name
SLC34A1
UniProt Synonym Gene Names
NPT2; SLC17A2; Sodium-phosphate transport protein 2A; Na(+)/Pi cotransporter 2A; NaPi-2a
UniProt Entry Name
NPT2A_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Additional Details
Product Notes
The SLC34A1 slc34a1 (Catalog #AAA199328) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC34A1 Antibody - N-terminal region reacts with Tested: Rat Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's SLC34A1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the SLC34A1 slc34a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YVPSPQVLHR IPGTTTYAIS SLSPVALTEH SCPYGEVLEC HDPLPAKLAQ. It is sometimes possible for the material contained within the vial of "SLC34A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
