Prestin Isoform A (SLC26A5) Antibody – Rabbit Polyclonal
SLC26A5 antibody - middle region
Gene Names
SLC26A5; PRES; DFNB61
Reactivity
Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, RatTested: Human
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
SLC26A5, Antibody; SLC26A5 antibody - middle region; anti-SLC26A5 antibody
Product Overview
Host
Rabbit
Reactivity
Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested: Human
Tested: Human
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FSVTISMAKTLANKHGYQVDGNQELIALGLCNSIGSLFQTFSISCSLSRS
Sequence Length
744
Applicable Applications for anti-SLC26A5 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SLC26A5
Protein Size
744 amino acids
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-SLC26A5 antibody
This is a rabbit polyclonal antibody against SLC26A5. It was validated on Western Blot and immunohistochemistry
Target Description: SLC26A5 is a member of the SLC26A/SulP transporter family. SLC26A5 is specifically expressed in outer hair cells (OHCs) of the cochlea and is essential in auditory processing. Intracellular anions are thought to act as extrinsic voltage sensors, which bind to this protein and trigger the conformational changes required for rapid length changes in OHCs. Mutations in its gene have been associated with non-syndromic hearing loss.This gene is a member of the SLC26A/SulP transporter family. It encodes a protein that is specifically expressed in outer hair cells (OHCs) of the cochlea and is essential in auditory processing. Intracellular anions are thought to act as extrinsic voltage sensors, which bind to this protein and trigger the conformational changes required for rapid length changes in OHCs. Mutations in this gene have been associated with non-syndromic hearing loss. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Target Description: SLC26A5 is a member of the SLC26A/SulP transporter family. SLC26A5 is specifically expressed in outer hair cells (OHCs) of the cochlea and is essential in auditory processing. Intracellular anions are thought to act as extrinsic voltage sensors, which bind to this protein and trigger the conformational changes required for rapid length changes in OHCs. Mutations in its gene have been associated with non-syndromic hearing loss.This gene is a member of the SLC26A/SulP transporter family. It encodes a protein that is specifically expressed in outer hair cells (OHCs) of the cochlea and is essential in auditory processing. Intracellular anions are thought to act as extrinsic voltage sensors, which bind to this protein and trigger the conformational changes required for rapid length changes in OHCs. Mutations in this gene have been associated with non-syndromic hearing loss. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Product Categories/Family for anti-SLC26A5 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
81kDa
NCBI Official Full Name
prestin isoform a
NCBI Official Synonym Full Names
solute carrier family 26 member 5
NCBI Official Symbol
SLC26A5
NCBI Official Synonym Symbols
PRES; DFNB61
NCBI Protein Information
prestin
UniProt Protein Name
Prestin
UniProt Gene Name
SLC26A5
UniProt Synonym Gene Names
PRES
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Additional Details
Product Notes
The SLC26A5 slc26a5 (Catalog #AAA199388) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC26A5 antibody - middle region reacts with Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat Tested: Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC26A5 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the SLC26A5 slc26a5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FSVTISMAKT LANKHGYQVD GNQELIALGL CNSIGSLFQT FSISCSLSRS. It is sometimes possible for the material contained within the vial of "SLC26A5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
