Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-SLC13A3 Polyclonal Antibody – Cat# AAA198905 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-SLC13A3 Antibody Titration: 2.5ug/mlPositive Control: Jurkat cell lysate)

Solute Carrier Family 13 Member 3 Isoform B (SLC13A3) Antibody – Rabbit Polyclonal

SLC13A3 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
SLC13A3; NADC3; SDCT2
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
SLC13A3, Antibody; SLC13A3 antibody - middle region; anti-SLC13A3 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GLSFRGWRKNKSEIRTNAEDRARAVIREEYQNLGPIKFAEQAVFILFCMF
Sequence Length
555
Applicable Applications for anti-SLC13A3 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 86%; Dog: 93%; Horse: 93%; Human: 100%; Mouse: 92%; Pig: 85%; Rabbit: 93%; Rat: 92%; Zebrafish: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SLC13A3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-SLC13A3 Antibody Titration: 2.5ug/mlPositive Control: Jurkat cell lysate)

Rabbit Anti-SLC13A3 Polyclonal Antibody – Cat# AAA198905 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-SLC13A3 Antibody Titration: 2.5ug/mlPositive Control: Jurkat cell lysate)

IHC (Immunohistochemistry)

(Rabbit Anti-SLC13A3 AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Rabbit Anti-SLC13A3 Polyclonal Antibody – Cat# AAA198905 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Rabbit Anti-SLC13A3 AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-SLC13A3 antibody
This is a rabbit polyclonal antibody against SLC13A3. It was validated on Western Blot and immunohistochemistry

Target Description: Mammalian sodium-dicarboxylate cotransporters transport succinate and other Krebs cycle intermediates. They fall into 2 categories based on their substrate affinity: low affinity and high affinity. Both the low- and high-affinity transporters play an important role in the handling of citrate by the kidneys. SLC13A3 represents the high-affinity form.Mammalian sodium-dicarboxylate cotransporters transport succinate and other Krebs cycle intermediates. They fall into 2 categories based on their substrate affinity: low affinity and high affinity. Both the low- and high-affinity transporters play an important role in the handling of citrate by the kidneys. The protein encoded by this gene represents the high-affinity form. Alternatively spliced transcript variants encoding different isoforms have been found for this gene, although the full-length nature of some of them have not been characterized yet.
Product Categories/Family for anti-SLC13A3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61kDa
NCBI Official Full Name
solute carrier family 13 member 3 isoform b
NCBI Official Synonym Full Names
solute carrier family 13 member 3
NCBI Official Symbol
SLC13A3
NCBI Official Synonym Symbols
NADC3; SDCT2
NCBI Protein Information
solute carrier family 13 member 3
UniProt Protein Name
Solute carrier family 13 member 3
UniProt Gene Name
SLC13A3
UniProt Synonym Gene Names
NADC3; SDCT2; NaDC-3; hNaDC3
UniProt Entry Name
S13A3_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The SLC13A3 slc13a3 (Catalog #AAA198905) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC13A3 antibody - middle region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SLC13A3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the SLC13A3 slc13a3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GLSFRGWRKN KSEIRTNAED RARAVIREEY QNLGPIKFAE QAVFILFCMF. It is sometimes possible for the material contained within the vial of "SLC13A3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.