Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-SLC11A2 Polyclonal Antibody – Cat# AAA199305 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-SLC11A2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysateSLC11A2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

Natural Resistance-Associated Macrophage Protein 2 Isoform 3 (SLC11A2) Antibody – Rabbit Polyclonal

SLC11A2 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
SLC11A2; DCT1; DMT1; AHMIO1; NRAMP2
Reactivity
Human, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SLC11A2, Antibody; SLC11A2 antibody - N-terminal region; anti-SLC11A2 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Specificity
Specific to all four isoforms of the SLC11A2 transporter.
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYF
Sequence Length
561
Applicable Applications for anti-SLC11A2 antibody
WB (Western Blot)
Homology
Human: 100%; Rat: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC11A2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-SLC11A2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysateSLC11A2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

Rabbit Anti-SLC11A2 Polyclonal Antibody – Cat# AAA199305 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-SLC11A2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysateSLC11A2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

WB (Western Blot)

(Host: RabbitTarget Name: SLC11A2Sample Tissue: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Rabbit Anti-SLC11A2 Polyclonal Antibody – Cat# AAA199305 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: SLC11A2Sample Tissue: Human Fetal LungAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-SLC11A2 antibody
This is a rabbit polyclonal antibody against SLC11A2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The SLC11A2 is a divalent metal transporter (DMT1), which carries iron, manganese, cobalt, nickel, cadmium, lead, copper, and zinc. DMT1 participates in cellular iron absorption at the luminal surface of the duodenum as well as in other areas of the body.The SLC11A2 gene encodes a divalent metal transporter (DMT1), which carries iron, manganese, cobalt, nickel, cadmium, lead, copper, and zinc. DMT1 participates in cellular iron absorption at the luminal surface of the duodenum as well as in other areas of the body (Hubert and Hentze, 2002 [PubMed 12209011]; Ludwiczek et al., 2007 [PubMed 17293870]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-SLC11A2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61kDa
NCBI Official Full Name
natural resistance-associated macrophage protein 2 isoform 3
NCBI Official Synonym Full Names
solute carrier family 11 member 2
NCBI Official Symbol
SLC11A2
NCBI Official Synonym Symbols
DCT1; DMT1; AHMIO1; NRAMP2
NCBI Protein Information
natural resistance-associated macrophage protein 2
UniProt Protein Name
Natural resistance-associated macrophage protein 2
UniProt Gene Name
SLC11A2
UniProt Synonym Gene Names
DCT1; DMT1; NRAMP2; NRAMP 2; DMT-1
UniProt Entry Name
NRAM2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The SLC11A2 slc11a2 (Catalog #AAA199305) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC11A2 antibody - N-terminal region reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SLC11A2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the SLC11A2 slc11a2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VLGPEQKMSD DSVSGDHGES ASLGNINPAY SNPSLSQSPG DSEEYFATYF. It is sometimes possible for the material contained within the vial of "SLC11A2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.