Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-SIX1 Polyclonal Antibody – Cat# AAA198376 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-Six1 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Kidney)

Homeobox Protein SIX1 (SIX1) Antibody – Rabbit Polyclonal

Six1 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
Six1; BB138287
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
Six1, Antibody; Six1 antibody - N-terminal region; anti-SIX1 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ERLGRFLWSLPACDHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSP
Sequence Length
284
Applicable Applications for anti-SIX1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-Six1 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Kidney)

Rabbit Anti-SIX1 Polyclonal Antibody – Cat# AAA198376 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-Six1 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Kidney)

IHC (Immunohistochemistry)

(Rabbit Anti-Six1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult heartObserved Staining: Cytoplasmic,Nuclear (very rare in Nuclear)Primary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

Rabbit Anti-SIX1 Polyclonal Antibody – Cat# AAA198376 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Rabbit Anti-Six1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult heartObserved Staining: Cytoplasmic,Nuclear (very rare in Nuclear)Primary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)
Related Product Information for anti-SIX1 antibody
This is a rabbit polyclonal antibody against Six1. It was validated on Western Blot

Target Description: Six1 is a transcription factor that is involved in regulation of organogenesis. It seems to be required for development of kidney, muscle and inner ear and to be involved in later steps of myogenic differentiation. It may be involved in limb tendon and ligament development. It binds a 5'-TCA[AG][AG]TTNC-3' motif present in the MEF3 element in the myogenin promoter. It is thought to be regulated by association with Dach and Eya proteins. Six1 acts as activator of the IGFBP5 promoter, probably coactivated by EYA2. Repression of precursor cell proliferation in myoblasts is switched to activation through recruitment of EYA3 phosphatase to the SIX1-DACH1 complex. During myogenesis, Six1 seems to act together with EYA2 and DACH2 .

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32kDa
NCBI Official Full Name
homeobox protein SIX1
NCBI Official Synonym Full Names
sine oculis-related homeobox 1
NCBI Official Symbol
Six1
NCBI Official Synonym Symbols
BB138287
NCBI Protein Information
homeobox protein SIX1
UniProt Protein Name
Homeobox protein SIX1
UniProt Gene Name
Six1
UniProt Entry Name
SIX1_MOUSE

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The SIX1 six1 (Catalog #AAA198376) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Six1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Six1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the SIX1 six1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ERLGRFLWSL PACDHLHKNE SVLKAKAVVA FHRGNFRELY KILESHQFSP. It is sometimes possible for the material contained within the vial of "Six1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.