Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23411_WB6.jpg WB (Western Blot) (WB Suggested Anti-SIRT4 antibody Titration: 1 ug/mLSample Type: Human Raji)

Rabbit SIRT4 Polyclonal Antibody | anti-SIRT4 antibody

SIRT4 antibody - middle region

Gene Names
SIRT4; SIR2L4
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
SIRT4, Antibody; SIRT4 antibody - middle region; anti-SIRT4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QVPTCVQCGGHLKPDVVFFGDTVNPDKVDFVHKRVKEADSLLVVGSSLQV
Sequence Length
314
Applicable Applications for anti-SIRT4 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 93%; Dog: 79%; Guinea Pig: 79%; Horse: 79%; Human: 100%; Mouse: 93%; Pig: 86%; Rabbit: 93%; Rat: 93%; Sheep: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SIRT4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-SIRT4 antibody Titration: 1 ug/mLSample Type: Human Raji)

product-image-AAA23411_WB6.jpg WB (Western Blot) (WB Suggested Anti-SIRT4 antibody Titration: 1 ug/mLSample Type: Human Raji)

WB (Western Blot)

(WB Suggested Anti-SIRT4 antibody Titration: 1 ug/mLSample Type: Human Liver)

product-image-AAA23411_WB5.jpg WB (Western Blot) (WB Suggested Anti-SIRT4 antibody Titration: 1 ug/mLSample Type: Human Liver)

WB (Western Blot)

(WB Suggested Anti-SIRT4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: MCF7 cell lysate)

product-image-AAA23411_WB4.jpg WB (Western Blot) (WB Suggested Anti-SIRT4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: MCF7 cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: SIRT4Sample Type: MCF7Lane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/lane/laneGel Concentration: 0.12)

product-image-AAA23411_WB3.jpg WB (Western Blot) (Host: RabbitTarget Name: SIRT4Sample Type: MCF7Lane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/lane/laneGel Concentration: 0.12)

WB (Western Blot)

(Host: RabbitTarget Name: SIRT4Sample Tissue: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

product-image-AAA23411_WB2.jpg WB (Western Blot) (Host: RabbitTarget Name: SIRT4Sample Tissue: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(Pancreas)

product-image-AAA23411_IHC.jpg IHC (Immunohistochemistry) (Pancreas)
Related Product Information for anti-SIRT4 antibody
This is a rabbit polyclonal antibody against SIRT4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SIRT4 is a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. SIRT4 is included in class IV of the sirtuin family.This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class IV of the sirtuin family.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
NAD-dependent protein lipoamidase sirtuin-4, mitochondrial
NCBI Official Synonym Full Names
sirtuin 4
NCBI Official Symbol
SIRT4
NCBI Official Synonym Symbols
SIR2L4
NCBI Protein Information
NAD-dependent protein lipoamidase sirtuin-4, mitochondrial
UniProt Protein Name
NAD-dependent protein deacetylase sirtuin-4
UniProt Gene Name
SIRT4
UniProt Entry Name
SIR4_HUMAN

Similar Products

Product Notes

The SIRT4 sirt4 (Catalog #AAA23411) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SIRT4 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's SIRT4 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the SIRT4 sirt4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QVPTCVQCGG HLKPDVVFFG DTVNPDKVDF VHKRVKEADS LLVVGSSLQV. It is sometimes possible for the material contained within the vial of "SIRT4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.