Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-SFPQ Polyclonal Antibody – Cat# AAA198705 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-SFPQ Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysateSFPQ is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Splicing Factor, Proline- And Glutamine-Rich (SFPQ) Antibody – Rabbit Polyclonal

SFPQ antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
SFPQ; PSF; POMP100; PPP1R140
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
SFPQ, Antibody; SFPQ antibody - middle region; anti-SFPQ antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PVIVEPLEQLDDEDGLPEKLAQKNPMYQKERETPPRFAQHGTFEYEYSQR
Sequence Length
707
Applicable Applications for anti-SFPQ antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SFPQ
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-SFPQ Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysateSFPQ is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Rabbit Anti-SFPQ Polyclonal Antibody – Cat# AAA198705 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-SFPQ Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysateSFPQ is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

IHC (Immunohiostchemistry)

(Rabbit Anti-SFPQ AntibodyParaffin Embedded Tissue: Human MuscleCellular Data: Skeletal muscle cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Rabbit Anti-SFPQ Polyclonal Antibody – Cat# AAA198705 – IHC (Immunohiostchemistry) IHC (Immunohiostchemistry) (Rabbit Anti-SFPQ AntibodyParaffin Embedded Tissue: Human MuscleCellular Data: Skeletal muscle cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

IHC (Immunohistochemistry)

(Rabbit Anti-SFPQ antibodyParaffin Embedded Tissue: Human Heartcell Cellular Data: cardiac cellAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Rabbit Anti-SFPQ Polyclonal Antibody – Cat# AAA198705 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Rabbit Anti-SFPQ antibodyParaffin Embedded Tissue: Human Heartcell Cellular Data: cardiac cellAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-SFPQ antibody
This is a rabbit polyclonal antibody against SFPQ. It was validated on Western Blot and immunohistochemistry

Target Description: SFPQ is DNA- and RNA binding protein. It is essential pre-mRNA splicing factor required early in spliceosome formation and for splicing catalytic step II, probably as an heteromer with NONO. It binds to pre-mRNA in spliceosome C complex, and specifically binds to intronic polypyrimidine tracts. It interacts with U5 snRNA. It may be involved in a pre-mRNA coupled splicing and polyadenylation process as component of a snRNP-free complex with SNRPA/U1A. SFPQ may be involved in homologous DNA pairing. SFPQ is involved in transcriptional regulation. It binds the DNA sequence 5'-CTGAGTC-3' in the insulin-like growth factor response element (IGFRE) and inhibits IGF-I-stimulated transcriptional activity.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
78kDa
NCBI Official Full Name
splicing factor, proline- and glutamine-rich
NCBI Official Synonym Full Names
splicing factor proline and glutamine rich
NCBI Official Symbol
SFPQ
NCBI Official Synonym Symbols
PSF; POMP100; PPP1R140
NCBI Protein Information
splicing factor, proline- and glutamine-rich
UniProt Protein Name
Splicing factor, proline- and glutamine-rich
UniProt Gene Name
SFPQ
UniProt Synonym Gene Names
PSF; hPOMp100; PSF; PTB-associated-splicing factor
UniProt Entry Name
SFPQ_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The SFPQ sfpq (Catalog #AAA198705) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SFPQ antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SFPQ can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the SFPQ sfpq for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PVIVEPLEQL DDEDGLPEKL AQKNPMYQKE RETPPRFAQH GTFEYEYSQR. It is sometimes possible for the material contained within the vial of "SFPQ, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.