Splicing Factor 1 Isoform 2 (SF1) Antibody – Rabbit Polyclonal
SF1 antibody - C-terminal region
Gene Names
SF1; BBP; MBBP; ZFM1; ZNF162; D11S636; ZCCHC25
Reactivity
Tested: HumanPredicted:Dog, Guinea Pig, Horse, Mouse, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SF1, Antibody; SF1 antibody - C-terminal region; anti-SF1 antibody
Product Overview
Host
Rabbit
Reactivity
Tested: Human
Predicted:Dog, Guinea Pig, Horse, Mouse, Rabbit
Predicted:Dog, Guinea Pig, Horse, Mouse, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: APPPPPPPPPGSAGMMIPPRGGDGPSHESEDFPRPLVTLPGRQPQQRPWW
Sequence Length
638
Applicable Applications for anti-SF1 antibody
WB (Western Blot)
Protein (#AA)
638 amino acids
Homology
Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human SF1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-SF1 antibody
This is a rabbit polyclonal antibody against SF1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: SF1 contains 1 CCHC-type zinc finger and 1 KH domain. SF1 is Necessary for the ATP-dependent first step of spliceosome assembly. It binds to the intron branch point sequence (BPS) 5'-UACUAAC-3' of the pre-mRNA. SF1 may act as transcription repressor.This gene encodes a member of the heat shock factor (HSF) family of transcriptional activators for heat shock proteins. This gene is a candidate gene for azoospermia, since it localizes to a region of chromosome Y that is sometimes deleted in infertile males. The genome has two identical copies of this gene within a palindromic region; this record represents the more centromeric copy. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Target Description: SF1 contains 1 CCHC-type zinc finger and 1 KH domain. SF1 is Necessary for the ATP-dependent first step of spliceosome assembly. It binds to the intron branch point sequence (BPS) 5'-UACUAAC-3' of the pre-mRNA. SF1 may act as transcription repressor.This gene encodes a member of the heat shock factor (HSF) family of transcriptional activators for heat shock proteins. This gene is a candidate gene for azoospermia, since it localizes to a region of chromosome Y that is sometimes deleted in infertile males. The genome has two identical copies of this gene within a palindromic region; this record represents the more centromeric copy. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Product Categories/Family for anti-SF1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
69kDa
NCBI Official Full Name
splicing factor 1 isoform 2
NCBI Official Synonym Full Names
splicing factor 1
NCBI Official Symbol
SF1
NCBI Official Synonym Symbols
BBP; MBBP; ZFM1; ZNF162; D11S636; ZCCHC25
NCBI Protein Information
splicing factor 1
UniProt Protein Name
Splicing factor 1
UniProt Gene Name
SF1
UniProt Synonym Gene Names
ZFM1; ZNF162; BBP; mBBP
UniProt Entry Name
SF01_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Additional Details
Product Notes
The SF1 sf1 (Catalog #AAA198843) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SF1 antibody - C-terminal region reacts with Tested: Human Predicted:Dog, Guinea Pig, Horse, Mouse, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's SF1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the SF1 sf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: APPPPPPPPP GSAGMMIPPR GGDGPSHESE DFPRPLVTLP GRQPQQRPWW. It is sometimes possible for the material contained within the vial of "SF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
