Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199703_WB10.jpg WB (Western Blot) (WB Suggested Anti-SEMA4F Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)

Rabbit SEMA4F Polyclonal Antibody | anti-SEMA4F antibody

SEMA4F antibody - N-terminal region

Gene Names
SEMA4F; S4F; SEMAM; SEMAW; M-SEMA; PRO2353; m-Sema-M
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SEMA4F, Antibody; SEMA4F antibody - N-terminal region; anti-SEMA4F antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PFSGERPRRIDWMVPEAHRQNCRKKGKKEGDLGGRKTLQQRWTTFLKADL
Sequence Length
615
Applicable Applications for anti-SEMA4F antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the n terminal region of human SEMA4F
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-SEMA4F Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)

product-image-AAA199703_WB10.jpg WB (Western Blot) (WB Suggested Anti-SEMA4F Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)

WB (Western Blot)

(Lanes:1. Untransfected MIA-PACA2 cell lysate2. Untransfected MIA-PACA2 cell lysate3. Untransfected MIA-PACA2 cell lysate4. hSEMA4F transfected MIA-PACA2 cell lysate5. Untransfected MIA-PACA2 cell lysate6. hSEMA4F transfected MIA-PACA2 cell lysatePrimary Antibody Dilution:1:600Secondary Antibody:Donkey Anti-rabbit HRPSecondary Antibody Dilution:1:3000Gene Name:SEMA4FSubmitted by:Dr. Tianliang Sun, Max Planck Institute for Heart and Lung Research)

product-image-AAA199703_WB11.jpg WB (Western Blot) (Lanes:1. Untransfected MIA-PACA2 cell lysate2. Untransfected MIA-PACA2 cell lysate3. Untransfected MIA-PACA2 cell lysate4. hSEMA4F transfected MIA-PACA2 cell lysate5. Untransfected MIA-PACA2 cell lysate6. hSEMA4F transfected MIA-PACA2 cell lysatePrimary Antibody Dilution:1:600Secondary Antibody:Donkey Anti-rabbit HRPSecondary Antibody Dilution:1:3000Gene Name:SEMA4FSubmitted by:Dr. Tianliang Sun, Max Planck Institute for Heart and Lung Research)

WB (Western Blot)

(Lanes:1. A431 cell lysate + control siRNA 2. A431 cell lysate + SEMA4F siRNAPrimary Antibody Dilution:1:600Secondary Antibody:Donkey Anti-rabbit HRPSecondary Antibody Dilution:1:3000Gene Name:SEMA4FSubmitted by:Dr. Tianliang Sun, Max Planck Institute for Heart and Lung Research)

product-image-AAA199703_WB13.jpg WB (Western Blot) (Lanes:1. A431 cell lysate + control siRNA 2. A431 cell lysate + SEMA4F siRNAPrimary Antibody Dilution:1:600Secondary Antibody:Donkey Anti-rabbit HRPSecondary Antibody Dilution:1:3000Gene Name:SEMA4FSubmitted by:Dr. Tianliang Sun, Max Planck Institute for Heart and Lung Research)

WB (Western Blot)

(human cell line A431Primary antibody dilution and incubation time:1:600, 4 degree overnightSecondary antibody used and dilution and incubation time: 1:3000, RT 2 hours)

product-image-AAA199703_WB15.jpg WB (Western Blot) (human cell line A431Primary antibody dilution and incubation time:1:600, 4 degree overnightSecondary antibody used and dilution and incubation time: 1:3000, RT 2 hours)
Related Product Information for anti-SEMA4F antibody
This is a rabbit polyclonal antibody against SEMA4F. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SEMA4F has growth cone collapse activity against retinal ganglion-cell axons.
Product Categories/Family for anti-SEMA4F antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
67kDa
NCBI Official Full Name
SEMA4F protein
NCBI Official Synonym Full Names
ssemaphorin 4F
NCBI Official Symbol
SEMA4F
NCBI Official Synonym Symbols
S4F; SEMAM; SEMAW; M-SEMA; PRO2353; m-Sema-M
NCBI Protein Information
semaphorin-4F
UniProt Protein Name
Semaphorin-4F
UniProt Gene Name
SEMA4F
UniProt Synonym Gene Names
SEMAM; SEMAW; Sema M; Sema W

Similar Products

Product Notes

The SEMA4F sema4f (Catalog #AAA199703) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SEMA4F antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SEMA4F can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the SEMA4F sema4f for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PFSGERPRRI DWMVPEAHRQ NCRKKGKKEG DLGGRKTLQQ RWTTFLKADL. It is sometimes possible for the material contained within the vial of "SEMA4F, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.