Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-SDHC Polyclonal Antibody – Cat# AAA201202 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: SDHCSample Type: NCI-H226 Whole cell lysatesAntibody Dilution: 1.0ug/ml)

Succinate Dehydrogenase Cytochrome B560 Subunit, Mitochondrial (SDHC) Antibody – Rabbit Polyclonal

SDHC Antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
SDHC; CYBL; PGL3; QPS1; SDH3; CYB560
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
SDHC, Antibody; SDHC Antibody - N-terminal region; anti-SDHC antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MAALLLRHVGRHCLRAHFSPQLCIRNAVPLGTTAKEEMERFWNKNIGSNR
Sequence Length
150
Applicable Applications for anti-SDHC antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human SDHC
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: SDHCSample Type: NCI-H226 Whole cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit Anti-SDHC Polyclonal Antibody – Cat# AAA201202 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: SDHCSample Type: NCI-H226 Whole cell lysatesAntibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-SDHC AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Cytoplasmic in mitochondriaPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit Anti-SDHC Polyclonal Antibody – Cat# AAA201202 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Rabbit Anti-SDHC AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Cytoplasmic in mitochondriaPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-SDHC antibody
This is a rabbit polyclonal antibody against SDHC. It was validated on Western Blot

Target Description: This gene encodes one of four nuclear-encoded subunits that comprise succinate dehydrogenase, also known as mitochondrial complex II, a key enzyme complex of the tricarboxylic acid cycle and aerobic respiratory chains of mitochondria. The encoded protein is one of two integral membrane proteins that anchor other subunits of the complex, which form the catalytic core, to the inner mitochondrial membrane. There are several related pseudogenes for this gene on different chromosomes. Mutations in this gene have been associated with paragangliomas. Alternatively spliced transcript variants have been described.
Product Categories/Family for anti-SDHC antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
16kDa
NCBI Official Full Name
Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
NCBI Official Synonym Full Names
succinate dehydrogenase complex subunit C
NCBI Official Symbol
SDHC
NCBI Official Synonym Symbols
CYBL; PGL3; QPS1; SDH3; CYB560
NCBI Protein Information
succinate dehydrogenase cytochrome b560 subunit, mitochondrial
UniProt Protein Name
Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
UniProt Gene Name
SDHC
UniProt Synonym Gene Names
CYB560; SDH3; QPs1; CYBL
UniProt Entry Name
C560_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The SDHC sdhc (Catalog #AAA201202) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SDHC Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SDHC can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the SDHC sdhc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MAALLLRHVG RHCLRAHFSP QLCIRNAVPL GTTAKEEMER FWNKNIGSNR. It is sometimes possible for the material contained within the vial of "SDHC, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.