Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-SCP2 Polyclonal Antibody – Cat# AAA200614 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-SCP2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysate)

Non-Specific Lipid-Transfer Protein Isoform 2 (SCP2) Antibody – Rabbit Polyclonal

SCP2 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
SCP2; NLTP; SCPX; SCP-2; SCP-X; NSL-TP; SCP-CHI
Reactivity
Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SCP2, Antibody; SCP2 antibody - middle region; anti-SCP2 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NHKHSVNNPYSQFQDEYSLDEVMASKEVFDFLTILQCCPTSDGAAAAILA
Sequence Length
322
Applicable Applications for anti-SCP2 antibody
WB (Western Blot)
Homology
Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SCP2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-SCP2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysate)

Rabbit Anti-SCP2 Polyclonal Antibody – Cat# AAA200614 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-SCP2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: SCP2Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Rabbit Anti-SCP2 Polyclonal Antibody – Cat# AAA200614 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: SCP2Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: SCP2Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Rabbit Anti-SCP2 Polyclonal Antibody – Cat# AAA200614 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: SCP2Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-SCP2 antibody
This is a rabbit polyclonal antibody against SCP2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SCP2 protein is thought to be an intracellular lipid transfer protein. SCP2 is highly expressed in organs involved in lipid metabolism, and may play a role in Zellweger syndrome, in which cells are deficient in peroxisomes and have impaired bile acid synthesis.This gene encodes two proteins: sterol carrier protein X (SCPx) and sterol carrier protein 2 (SCP2), as a result of transcription initiation from 2 independently regulated promoters. The transcript initiated from the proximal promoter encodes the longer SCPx protein, and the transcript initiated from the distal promoter encodes the shorter SCP2 protein, with the 2 proteins sharing a common C-terminus. Evidence suggests that the SCPx protein is a peroxisome-associated thiolase that is involved in the oxidation of branched chain fatty acids, while the SCP2 protein is thought to be an intracellular lipid transfer protein. This gene is highly expressed in organs involved in lipid metabolism, and may play a role in Zellweger syndrome, in which cells are deficient in peroxisomes and have impaired bile acid synthesis. Alternative splicing of this gene produces multiple transcript variants, some encoding different isoforms. The full-length nature of all transcript variants has not been determined.
Product Categories/Family for anti-SCP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
non-specific lipid-transfer protein isoform 2
NCBI Official Synonym Full Names
sterol carrier protein 2
NCBI Official Symbol
SCP2
NCBI Official Synonym Symbols
NLTP; SCPX; SCP-2; SCP-X; NSL-TP; SCP-CHI
NCBI Protein Information
non-specific lipid-transfer protein

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The SCP2 (Catalog #AAA200614) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SCP2 antibody - middle region reacts with Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SCP2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the SCP2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NHKHSVNNPY SQFQDEYSLD EVMASKEVFD FLTILQCCPT SDGAAAAILA. It is sometimes possible for the material contained within the vial of "SCP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.