Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-SART3 Polyclonal Antibody – Cat# AAA198444 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-SART3 Antibody Titration: 2.5ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysateSART3 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

KIAA0156 Isoform (SART3) Antibody – Rabbit Polyclonal

SART3 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
SART3; P100; p110; DSAP1; TIP110; p110(nrb); RP11-13G14
Reactivity
Dog, Guinea Pig, Horse, Human, Pig, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
SART3, Antibody; SART3 antibody - N-terminal region; anti-SART3 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TSASEPEAESKAGPKADGEEDEVKAARTRRKVLSRAVAAATYKTMGPAWD
Sequence Length
364
Applicable Applications for anti-SART3 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Dog: 77%; Guinea Pig: 79%; Horse: 79%; Human: 100%; Pig: 86%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SART3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-SART3 Antibody Titration: 2.5ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysateSART3 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Rabbit Anti-SART3 Polyclonal Antibody – Cat# AAA198444 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-SART3 Antibody Titration: 2.5ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysateSART3 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

IHC (Immunohistochemistry)

(Human Liver)

Rabbit Anti-SART3 Polyclonal Antibody – Cat# AAA198444 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Human Liver)
Related Product Information for anti-SART3 antibody
This is a rabbit polyclonal antibody against SART3. It was validated on Western Blot and immunohistochemistry

Target Description: SART3 is an RNA-binding nuclear protein that is a tumor-rejection antigen. This antigen possesses tumor epitopes capable of inducing HLA-A24-restricted and tumor-specific cytotoxic T lymphocytes in cancer patients and may be useful for specific immunotherapy. SART3 is found to be an important cellular factor for HIV-1 gene expression and viral replication. It also associates transiently with U6 and U4/U6 snRNPs during the recycling phase of the spliceosome cycle. This protein is thought to be involved in the regulation of mRNA splicing.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
KIAA0156 isoform
NCBI Official Synonym Full Names
spliceosome associated factor 3, U4/U6 recycling protein
NCBI Official Symbol
SART3
NCBI Official Synonym Symbols
P100; p110; DSAP1; TIP110; p110(nrb); RP11-13G14
NCBI Protein Information
squamous cell carcinoma antigen recognized by T-cells 3
UniProt Protein Name
Squamous cell carcinoma antigen recognized by T-cells 3
UniProt Gene Name
SART3
UniProt Synonym Gene Names
SART-3
UniProt Entry Name
SART3_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The SART3 sart3 (Catalog #AAA198444) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SART3 antibody - N-terminal region reacts with Dog, Guinea Pig, Horse, Human, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SART3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the SART3 sart3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TSASEPEAES KAGPKADGEE DEVKAARTRR KVLSRAVAAA TYKTMGPAWD. It is sometimes possible for the material contained within the vial of "SART3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.