Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-SAP18 Polyclonal Antibody – Cat# AAA198372 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-SAP18 Antibody Titration: 0.125ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)

Histone Deacetylase Complex Subunit SAP18 Isoform 1 (SAP18) Antibody – Rabbit Polyclonal

SAP18 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
SAP18; SAP18P; 2HOR0202
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
SAP18, Antibody; SAP18 antibody - N-terminal region; anti-SAP18 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EIKKEPEKPIDREKTCPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYT
Sequence Length
153
Applicable Applications for anti-SAP18 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SAP18
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-SAP18 Antibody Titration: 0.125ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)

Rabbit Anti-SAP18 Polyclonal Antibody – Cat# AAA198372 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-SAP18 Antibody Titration: 0.125ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)

IHC (Immunohistochemistry)

(Rabbit Anti-SAP18 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Testis TissueObserved Staining: Cytoplasm in spermatogonia and spermatocytesPrimary Antibody Concentration: N/AOther Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit Anti-SAP18 Polyclonal Antibody – Cat# AAA198372 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Rabbit Anti-SAP18 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Testis TissueObserved Staining: Cytoplasm in spermatogonia and spermatocytesPrimary Antibody Concentration: N/AOther Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-SAP18 antibody
This is a rabbit polyclonal antibody against SAP18. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Histone acetylation plays a key role in the regulation of eukaryotic gene expression. Histone acetylation and deacetylation are catalyzed by multisubunit complexes. SAP18 is a component of the histone deacetylase complex, which includes SIN3, SAP30, HDAC1, HDAC2, RbAp46, RbAp48, and other polypeptides. This protein directly interacts with SIN3 and enhances SIN3-mediated transcriptional repression when tethered to the promoter.Histone acetylation plays a key role in the regulation of eukaryotic gene expression. Histone acetylation and deacetylation are catalyzed by multisubunit complexes. The protein encoded by this gene is a component of the histone deacetylase complex, which includes SIN3, SAP30, HDAC1, HDAC2, RbAp46, RbAp48, and other polypeptides. This protein directly interacts with SIN3 and enhances SIN3-mediated transcriptional repression when tethered to the promoter.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18kDa
NCBI Official Full Name
histone deacetylase complex subunit SAP18 isoform 1
NCBI Official Synonym Full Names
Sin3A associated protein 18
NCBI Official Symbol
SAP18
NCBI Official Synonym Symbols
SAP18P; 2HOR0202
NCBI Protein Information
histone deacetylase complex subunit SAP18
UniProt Protein Name
Histone deacetylase complex subunit SAP18
UniProt Gene Name
SAP18
UniProt Entry Name
SAP18_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The SAP18 sap18 (Catalog #AAA198372) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SAP18 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SAP18 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the SAP18 sap18 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EIKKEPEKPI DREKTCPLLL RVFTTNNGRH HRMDEFSRGN VPSSELQIYT. It is sometimes possible for the material contained within the vial of "SAP18, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.