Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-RUNX1 Polyclonal Antibody – Cat# AAA201761 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-RUNX1 Antibody Titration: 5% MilkELISA Titer: dilution: 1:500Positive Control: Human LCL and mouse brains)

Runt-Related Transcription Factor 1 Isoform AML1C (RUNX1) Antibody – Rabbit Polyclonal

RUNX1 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
RUNX1; AML1; CBFA2; EVI-1; AMLCR1; PEBP2aB; CBF2alpha; AML1-EVI-1; PEBP2alpha
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
RUNX1, Antibody; RUNX1 antibody - middle region; anti-RUNX1 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPAT
Sequence Length
480
Applicable Applications for anti-RUNX1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 92%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RUNX1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-RUNX1 Antibody Titration: 5% MilkELISA Titer: dilution: 1:500Positive Control: Human LCL and mouse brains)

Rabbit Anti-RUNX1 Polyclonal Antibody – Cat# AAA201761 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-RUNX1 Antibody Titration: 5% MilkELISA Titer: dilution: 1:500Positive Control: Human LCL and mouse brains)

WB (Western Blot)

(WB Suggested Anti-RUNX1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: SH-SYSY cell lysate)

Rabbit Anti-RUNX1 Polyclonal Antibody – Cat# AAA201761 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-RUNX1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: SH-SYSY cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: RUNX1Sample Tissue: Human MCF7 Whole CellAntibody Dilution: 1ug/ml)

Rabbit Anti-RUNX1 Polyclonal Antibody – Cat# AAA201761 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: RUNX1Sample Tissue: Human MCF7 Whole CellAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Sample Type :Mouse embryonic d13 spinal motor neuronsPrimary Antibody Dilution :1:1000Secondary Antibody :Donkey anti rabbit IgG Alexa 594Secondary Antibody Dilution :1:1000Color/Signal Descriptions :RUNX1: Red LSL1:: GreenGene Name :RUNX1 Submitted by :Anonymous)

Rabbit Anti-RUNX1 Polyclonal Antibody – Cat# AAA201761 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Sample Type :Mouse embryonic d13 spinal motor neuronsPrimary Antibody Dilution :1:1000Secondary Antibody :Donkey anti rabbit IgG Alexa 594Secondary Antibody Dilution :1:1000Color/Signal Descriptions :RUNX1: Red LSL1:: GreenGene Name :RUNX1 Submitted by :Anonymous)
Related Product Information for anti-RUNX1 antibody
This is a rabbit polyclonal antibody against RUNX1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Core binding factor (CBF) is a heterodimeric transcription factor that binds to the core element of many enhancers and promoters. RUNX1 is the alpha subunit of CBF and is thought to be involved in the development of normal hematopoiesis. Chromosomal translocations involving this gene are well-documented and have been associated with severaltypes of leukemia. Core binding factor (CBF) is a heterodimeric transcription factor that binds to the core element of many enhancers and promoters. The protein encoded by this gene represents the alpha subunit of CBF and is thought to be involved in the development of normal hematopoiesis. Chromosomal translocations involving this gene are well-documented and have been associated with several types of leukemia. Three transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
861
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52kDa
NCBI Official Full Name
runt-related transcription factor 1 isoform AML1c
NCBI Official Synonym Full Names
runt related transcription factor 1
NCBI Official Symbol
RUNX1
NCBI Official Synonym Symbols
AML1; CBFA2; EVI-1; AMLCR1; PEBP2aB; CBF2alpha; AML1-EVI-1; PEBP2alpha
NCBI Protein Information
runt-related transcription factor 1

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The RUNX1 (Catalog #AAA201761) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RUNX1 antibody - middle region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RUNX1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the RUNX1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ASLNHSTAFN PQPQSQMQDT RQIQPSPPWS YDQSYQYLGS IASPSVHPAT. It is sometimes possible for the material contained within the vial of "RUNX1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.