Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-RORC Polyclonal Antibody – Cat# AAA197546 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-RORC Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human kidney)

Nuclear Receptor ROR-Gamma Isoform A (RORC) Antibody – Rabbit Polyclonal

RORC antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
RORC; TOR; RORG; RZRG; IMD42; NR1F3; RZR-GAMMA
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RORC, Antibody; RORC antibody - C-terminal region; anti-RORC antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILA
Sequence Length
518
Applicable Applications for anti-RORC antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 85%; Rabbit: 92%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human RORC
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-RORC Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human kidney)

Rabbit Anti-RORC Polyclonal Antibody – Cat# AAA197546 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-RORC Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human kidney)

WB (Western Blot)

(Host: RabbitTarget Name: RORCSample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

Rabbit Anti-RORC Polyclonal Antibody – Cat# AAA197546 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: RORCSample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-RORC antibody
This is a rabbit polyclonal antibody against RORC. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: RORC encodes a protein which is a DNA-binding transcription factor and is a member of the NR1 subfamily of nuclear hormone receptors. The specific functions of this protein are not known; however, studies of a similar gene in mice have shown that RORC may be essential for lymphoid organogenesis and may play an important regulatory role in thymopoiesis. In addition, studies in mice suggest that the protein encoded by this gene may inhibit the expression of Fas ligand and IL2.The protein encoded by this gene is a DNA-binding transcription factor and is a member of the NR1 subfamily of nuclear hormone receptors. The specific functions of this protein are not known; however, studies of a similar gene in mice have shown that this gene may be essential for lymphoid organogenesis and may play an important regulatory role in thymopoiesis. In addition, studies in mice suggest that the protein encoded by this gene may inhibit the expression of Fas ligand and IL2. Two transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58kDa
NCBI Official Full Name
nuclear receptor ROR-gamma isoform a
NCBI Official Synonym Full Names
RAR related orphan receptor C
NCBI Official Symbol
RORC
NCBI Official Synonym Symbols
TOR; RORG; RZRG; IMD42; NR1F3; RZR-GAMMA
NCBI Protein Information
nuclear receptor ROR-gamma
UniProt Protein Name
Nuclear receptor ROR-gamma
UniProt Gene Name
RORC
UniProt Synonym Gene Names
NR1F3; RORG; RZRG
UniProt Entry Name
RORG_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The RORC rorc (Catalog #AAA197546) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RORC antibody - C-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RORC can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the RORC rorc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DEIALYTALV LINAHRPGLQ EKRKVEQLQY NLELAFHHHL CKTHRQSILA. It is sometimes possible for the material contained within the vial of "RORC, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.