Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-RNF39 Polyclonal Antibody – Cat# AAA199258 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-RNF39 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

RING Finger Protein 39 Isoform 2 (RNF39) Antibody – Rabbit Polyclonal

RNF39 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
RNF39; HZF; HZFW; LIRF
Reactivity
Horse, Human
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
RNF39, Antibody; RNF39 antibody - N-terminal region; anti-RNF39 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Horse, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EGRKAAKVNAGVGEKGIYTASSRGGPPSARSKAVTVVAEGAASRSWLSMD
Sequence Length
354
Applicable Applications for anti-RNF39 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Horse: 92%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human RNF39
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-RNF39 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

Rabbit Anti-RNF39 Polyclonal Antibody – Cat# AAA199258 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-RNF39 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

IHC (Immunohistochemistry)

(Human Intestine)

Rabbit Anti-RNF39 Polyclonal Antibody – Cat# AAA199258 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Human Intestine)
Related Product Information for anti-RNF39 antibody
This is a rabbit polyclonal antibody against RNF39. It was validated on Western Blot and immunohistochemistry

Target Description: Its gene lies within the major histocompatibility complex class I region on chromosome 6. Studies of a similar rat protein suggest that RNF39 plays a role in an early phase of synaptic plasticity. Its gene lies within the major histocompatibility complex class I region on chromosome 6.This gene lies within the major histocompatibility complex class I region on chromosome 6. Studies of a similar rat protein suggest that this gene encodes a protein that plays a role in an early phase of synaptic plasticity. Alternative splicing results in three transcript variants encoding different isoforms.
Product Categories/Family for anti-RNF39 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
RING finger protein 39 isoform 2
NCBI Official Synonym Full Names
ring finger protein 39
NCBI Official Symbol
RNF39
NCBI Official Synonym Symbols
HZF; HZFW; LIRF
NCBI Protein Information
RING finger protein 39

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The RNF39 (Catalog #AAA199258) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RNF39 antibody - N-terminal region reacts with Horse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's RNF39 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the RNF39 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EGRKAAKVNA GVGEKGIYTA SSRGGPPSAR SKAVTVVAEG AASRSWLSMD. It is sometimes possible for the material contained within the vial of "RNF39, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.