Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-TRIM13 Polyclonal Antibody – Cat# AAA197736 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-RFP2 Antibody Titration: 0.125ug/mlELISA Titer: 1:62500Positive Control: Human Lung)

E3 Ubiquitin-Protein Ligase TRIM13 Isoform 2 (TRIM13) Antibody – Rabbit Polyclonal

RFP2 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
TRIM13; CAR; LEU5; RFP2; DLEU5; RNF77
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
RFP2, Antibody; RFP2 antibody - middle region; anti-TRIM13 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DTLETSKRKSLQLLTKDSDKVKEFFEKLQHTLDQKKNEILSDFETMKLAV
Sequence Length
410
Applicable Applications for anti-TRIM13 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RFP2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-RFP2 Antibody Titration: 0.125ug/mlELISA Titer: 1:62500Positive Control: Human Lung)

Rabbit Anti-TRIM13 Polyclonal Antibody – Cat# AAA197736 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-RFP2 Antibody Titration: 0.125ug/mlELISA Titer: 1:62500Positive Control: Human Lung)

WB (Western Blot)

(Host: RabbitTarget Name: TRIM13Sample Tissue: Human DLD1 Whole CellAntibody Dilution: 1ug/ml)

Rabbit Anti-TRIM13 Polyclonal Antibody – Cat# AAA197736 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: TRIM13Sample Tissue: Human DLD1 Whole CellAntibody Dilution: 1ug/ml)

IHC (Immunohistochemisry)

(Rabbit Anti-TRIM13 AntibodyParaffin Embedded Tissue: Human alveolar cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Rabbit Anti-TRIM13 Polyclonal Antibody – Cat# AAA197736 – IHC (Immunohistochemisry) IHC (Immunohistochemisry) (Rabbit Anti-TRIM13 AntibodyParaffin Embedded Tissue: Human alveolar cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

IHC (Immunohiostchemistry)

(Human Lung)

Rabbit Anti-TRIM13 Polyclonal Antibody – Cat# AAA197736 – IHC (Immunohiostchemistry) IHC (Immunohiostchemistry) (Human Lung)

IHC (Immunohistochemistry)

(Human kidney)

Rabbit Anti-TRIM13 Polyclonal Antibody – Cat# AAA197736 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Human kidney)
Related Product Information for anti-TRIM13 antibody
This is a rabbit polyclonal antibody against RFP2. It was validated on Western Blot and immunohistochemistry

Target Description: The protein encoded by the RFP2 gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies near the nucleus, but its function is unknown. The gene is located on chromosome 13 within the minimal deletion region for B-cell chronic lymphocytic leukemia.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase TRIM13 isoform 2
NCBI Official Synonym Full Names
tripartite motif containing 13
NCBI Official Symbol
TRIM13
NCBI Official Synonym Symbols
CAR; LEU5; RFP2; DLEU5; RNF77
NCBI Protein Information
E3 ubiquitin-protein ligase TRIM13

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The TRIM13 (Catalog #AAA197736) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RFP2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RFP2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the TRIM13 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DTLETSKRKS LQLLTKDSDK VKEFFEKLQH TLDQKKNEIL SDFETMKLAV. It is sometimes possible for the material contained within the vial of "RFP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.