Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-REST Polyclonal Antibody – Cat# AAA197285 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: RESTSample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

RE1-Silencing Transcription Factor (REST) Antibody – Rabbit Polyclonal

REST Antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
REST; WT6; XBR; HGF5; NRSF; DFNA27; GINGF5
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity purified
Synonyms
REST, Antibody; REST Antibody - N-terminal region; anti-REST antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SGSSTAEEGDFSKGPIRCDRCGYNTNRYDHYTAHLKHHTRAGDNERVYKC
Sequence Length
1097
Applicable Applications for anti-REST antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human REST
Protein Size (#AA)
1097 amino acids
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: RESTSample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit Anti-REST Polyclonal Antibody – Cat# AAA197285 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: RESTSample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-REST antibody
This is a rabbit polyclonal antibody against REST. It was validated on Western Blot

Target Description: This gene encodes a transcriptional repressor that represses neuronal genes in non-neuronal tissues. It is a member of the Kruppel-type zinc finger transcription factor family. It represses transcription by binding a DNA sequence element called the neuron-restrictive silencer element. The protein is also found in undifferentiated neuronal progenitor cells and it is thought that this repressor may act as a master negative regular of neurogenesis. Alternatively spliced transcript variants have been described.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
120kDa
NCBI Official Full Name
RE1-silencing transcription factor
NCBI Official Synonym Full Names
RE1 silencing transcription factor
NCBI Official Symbol
REST
NCBI Official Synonym Symbols
WT6; XBR; HGF5; NRSF; DFNA27; GINGF5
NCBI Protein Information
RE1-silencing transcription factor
UniProt Protein Name
RE1-silencing transcription factor
UniProt Gene Name
REST
UniProt Synonym Gene Names
NRSF; XBR
UniProt Entry Name
REST_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The REST rest (Catalog #AAA197285) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The REST Antibody - N-terminal region reacts with Tested Species Reactivity: Human Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's REST can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the REST rest for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SGSSTAEEGD FSKGPIRCDR CGYNTNRYDH YTAHLKHHTR AGDNERVYKC. It is sometimes possible for the material contained within the vial of "REST, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.