Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-RBBP8 Polyclonal Antibody – Cat# AAA200120 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-RBBP8 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)

DNA Endonuclease RBBP8 Isoform B (RBBP8) Antibody – Rabbit Polyclonal

RBBP8 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
RBBP8; RIM; COM1; CTIP; JWDS; SAE2; SCKL2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RBBP8, Antibody; RBBP8 antibody - C-terminal region; anti-RBBP8 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ETVDMDCTLVSETVLLKMKKQEQKGEKSSNEERKMNDSLEDMFDRTTHEE
Sequence Length
867
Applicable Applications for anti-RBBP8 antibody
WB (Western Blot)
Homology
Cow: 79%; Dog: 86%; Guinea Pig: 83%; Horse: 79%; Human: 100%; Pig: 100%; Rabbit: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human RBBP8
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-RBBP8 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)

Rabbit Anti-RBBP8 Polyclonal Antibody – Cat# AAA200120 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-RBBP8 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)

WB (Western Blot)

(Host: RabbitTarget Name: RBBP8Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

Rabbit Anti-RBBP8 Polyclonal Antibody – Cat# AAA200120 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: RBBP8Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Sample Type: r-RBBP8Sample type: 1. HCT116 lysate (50ug)2. MCF7 lysate (50ug)3. rCtIP (30ng)Primary Dilution: 1:1000Secondary Antibody: anti-Rabbit IR700Secondary Dilution: 1:5000Image Submitted by: Nodar MakharashviliUniversity of Texas, Austin )

Rabbit Anti-RBBP8 Polyclonal Antibody – Cat# AAA200120 – WB (Western Blot) WB (Western Blot) (Sample Type: r-RBBP8Sample type: 1. HCT116 lysate (50ug)2. MCF7 lysate (50ug)3. rCtIP (30ng)Primary Dilution: 1:1000Secondary Antibody: anti-Rabbit IR700Secondary Dilution: 1:5000Image Submitted by: Nodar MakharashviliUniversity of Texas, Austin )
Related Product Information for anti-RBBP8 antibody
This is a rabbit polyclonal antibody against RBBP8. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: RBBP8 is a ubiquitously expressed nuclear protein. It is found among several proteins that bind directly to retinoblastoma protein, which regulates cell proliferation. This protein complexes with transcriptional co-repressor CTBP. It is also associated with BRCA1 and is thought to modulate the functions of BRCA1 in transcriptional regulation, DNA repair, and/or cell cycle checkpoint control. It is suggested that this gene may itself be a tumor suppressor acting in the same pathway as BRCA1. Three transcript variants encoding two different isoforms have been found for this gene. More transcript variants exist, but their full-length natures have not been determined.The protein encoded by this gene is a ubiquitously expressed nuclear protein. It is found among several proteins that bind directly to retinoblastoma protein, which regulates cell proliferation. This protein complexes with transcriptional co-repressor CTBP. It is also associated with BRCA1 and is thought to modulate the functions of BRCA1 in transcriptional regulation, DNA repair, and/or cell cycle checkpoint control. It is suggested that this gene may itself be a tumor suppressor acting in the same pathway as BRCA1. Three transcript variants encoding two different isoforms have been found for this gene. More transcript variants exist, but their full-length natures have not been determined.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
98kDa
NCBI Official Full Name
DNA endonuclease RBBP8 isoform b
NCBI Official Synonym Full Names
RB binding protein 8, endonuclease
NCBI Official Symbol
RBBP8
NCBI Official Synonym Symbols
RIM; COM1; CTIP; JWDS; SAE2; SCKL2
NCBI Protein Information
DNA endonuclease RBBP8
UniProt Protein Name
DNA endonuclease RBBP8
UniProt Gene Name
RBBP8
UniProt Synonym Gene Names
CTIP; CtIP; RBBP-8; RIM; SAE2
UniProt Entry Name
COM1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The RBBP8 rbbp8 (Catalog #AAA200120) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RBBP8 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's RBBP8 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the RBBP8 rbbp8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ETVDMDCTLV SETVLLKMKK QEQKGEKSSN EERKMNDSLE DMFDRTTHEE. It is sometimes possible for the material contained within the vial of "RBBP8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.