Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-RAB5A Polyclonal Antibody – Cat# AAA200623 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-RAB5A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Muscle)

Ras-Related Protein Rab-5A Isoform 1 (RAB5A) Antibody – Rabbit Polyclonal

RAB5A antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
RAB5A; RAB5
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
RAB5A, Antibody; RAB5A antibody - middle region; anti-RAB5A antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCS
Sequence Length
215
Applicable Applications for anti-RAB5A antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RAB5A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-RAB5A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Muscle)

Rabbit Anti-RAB5A Polyclonal Antibody – Cat# AAA200623 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-RAB5A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Muscle)

WB (Western Blot)

(Host: MouseTarget Name: RAB5ASample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)

Rabbit Anti-RAB5A Polyclonal Antibody – Cat# AAA200623 – WB (Western Blot) WB (Western Blot) (Host: MouseTarget Name: RAB5ASample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)

IHC (Immunohiostchemistry)

(Sample Type: Zebrafish gutSample type: zebra gut epithelial cellsGreen: primaryRed: actinBlue: DAPIPrimary dilution: 1:5000Secondary Dilution: 1:300Image Submitted by: Michel BagnatDuke University Medical Center See Customer Feedback tab for detailed information.)

Rabbit Anti-RAB5A Polyclonal Antibody – Cat# AAA200623 – IHC (Immunohiostchemistry) IHC (Immunohiostchemistry) (Sample Type: Zebrafish gutSample type: zebra gut epithelial cellsGreen: primaryRed: actinBlue: DAPIPrimary dilution: 1:5000Secondary Dilution: 1:300Image Submitted by: Michel BagnatDuke University Medical Center See Customer Feedback tab for detailed information.)

IHC (Immunohistochemistry)

(Sample Type: Zebrafish gutSample type: zebra gut epithelial cellsGreen: primaryRed: actinBlue: DAPIPrimary dilution: 1:5000Secondary Dilution: 1:300Image Submitted by: Michel BagnatDuke University Medical Center See Customer Feedback tab for detailed information.)

Rabbit Anti-RAB5A Polyclonal Antibody – Cat# AAA200623 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Sample Type: Zebrafish gutSample type: zebra gut epithelial cellsGreen: primaryRed: actinBlue: DAPIPrimary dilution: 1:5000Secondary Dilution: 1:300Image Submitted by: Michel BagnatDuke University Medical Center See Customer Feedback tab for detailed information.)
Related Product Information for anti-RAB5A antibody
This is a rabbit polyclonal antibody against RAB5A. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: RAB5A is required for the fusion of plasma membranes and early endosomes.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
ras-related protein Rab-5A isoform 1
NCBI Official Synonym Full Names
RAB5A, member RAS oncogene family
NCBI Official Symbol
RAB5A
NCBI Official Synonym Symbols
RAB5
NCBI Protein Information
ras-related protein Rab-5A
UniProt Protein Name
Ras-related protein Rab-5A
UniProt Gene Name
RAB5A
UniProt Synonym Gene Names
RAB5
UniProt Entry Name
RAB5A_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The RAB5A rab5a (Catalog #AAA200623) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RAB5A antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's RAB5A can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the RAB5A rab5a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KTSMNVNEIF MAIAKKLPKN EPQNPGANSA RGRGVDLTEP TQPTRNQCCS. It is sometimes possible for the material contained within the vial of "RAB5A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.