Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-PSMB2 Polyclonal Antibody – Cat# AAA200602 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-PSMB2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysatePSMB2 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)

Proteasome Subunit Beta Type-2 Isoform 1 (PSMB2) Antibody – Rabbit Polyclonal

PSMB2 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
PSMB2; HC7-I
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PSMB2, Antibody; PSMB2 antibody - middle region; anti-PSMB2 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLD
Sequence Length
201
Applicable Applications for anti-PSMB2 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PSMB2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-PSMB2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysatePSMB2 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)

Rabbit Anti-PSMB2 Polyclonal Antibody – Cat# AAA200602 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-PSMB2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysatePSMB2 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)

WB (Western Blot)

(Host: RabbitTarget Name: PSMB2Sample Type: JurkatAntibody Dilution: 1.0ug/mlPSMB2 is strongly supported by BioGPS gene expression data to be expressed in Jurkat)

Rabbit Anti-PSMB2 Polyclonal Antibody – Cat# AAA200602 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: PSMB2Sample Type: JurkatAntibody Dilution: 1.0ug/mlPSMB2 is strongly supported by BioGPS gene expression data to be expressed in Jurkat)

WB (Western Blot)

(Host: RabbitTarget Name: PSMB2Sample Type: HepG2Antibody Dilution: 1.0ug/mlPSMB2 is supported by BioGPS gene expression data to be expressed in HepG2)

Rabbit Anti-PSMB2 Polyclonal Antibody – Cat# AAA200602 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: PSMB2Sample Type: HepG2Antibody Dilution: 1.0ug/mlPSMB2 is supported by BioGPS gene expression data to be expressed in HepG2)

WB (Western Blot)

(Host: RabbitTarget Name: PSMB2Sample Type: 293TAntibody Dilution: 1.0ug/mlPSMB2 is supported by BioGPS gene expression data to be expressed in HEK293T)

Rabbit Anti-PSMB2 Polyclonal Antibody – Cat# AAA200602 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: PSMB2Sample Type: 293TAntibody Dilution: 1.0ug/mlPSMB2 is supported by BioGPS gene expression data to be expressed in HEK293T)
Related Product Information for anti-PSMB2 antibody
This is a rabbit polyclonal antibody against PSMB2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMB2 is a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-PSMB2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
proteasome subunit beta type-2 isoform 1
NCBI Official Synonym Full Names
proteasome subunit beta 2
NCBI Official Symbol
PSMB2
NCBI Official Synonym Symbols
HC7-I
NCBI Protein Information
proteasome subunit beta type-2
UniProt Protein Name
Proteasome subunit beta type-2
UniProt Gene Name
PSMB2
UniProt Entry Name
PSB2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The PSMB2 psmb2 (Catalog #AAA200602) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PSMB2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PSMB2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the PSMB2 psmb2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LDRYYTPTIS RERAVELLRK CLEELQKRFI LNLPTFSVRI IDKNGIHDLD. It is sometimes possible for the material contained within the vial of "PSMB2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.