Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA21304_IHC7.jpg IHC (Immunohistochemistry) (PSMA3 Antibody-Immunohistochemistry of paraffin-embedded rat lung using PSMA3 antibody at dilution of 1:200 (400x lens).)

Rabbit anti-Mouse, Human PSMA3 Polyclonal Antibody | anti-PSMA3 antibody

PSMA3 Rabbit anti-Human Polyclonal Antibody

Gene Names
PSMA3; HC8; PSC3
Reactivity
Mouse, Human
Applications
Immunofluorescence, Immunohistochemistry, Immunohistochemistry, Immunoprecipitation, Western Blot
Purity
Affinity purified
Synonyms
PSMA3, Antibody; PSMA3 Rabbit anti-Human Polyclonal Antibody; IHC-plus PSMA3 Antibody; PSMA3; Proteasome component C8; Proteasome subunit C8; PSC8; HC8; Macropain subunit C8; PSC3; anti-PSMA3 antibody
Ordering
Host
Rabbit
Reactivity
Mouse, Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Human HC8/PSMA3
Purity/Purification
Affinity purified
Form/Format
PBS, pH7.3, 0.02% Sodium Azide, 50% Glycerol
Applicable Applications for anti-PSMA3 antibody
Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry-Paraffin (IHC-P), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
IF: 1:50-1:200
IHC: 1:50-1:200
IHC-P: 1:200
WB: 1:500-1:2000
The predicted MW is 27kDa/28kDa, while the observed MW by Western blot was 28kDa.
Target
Human PSMA3
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-255 of human PSMA3 (NP_002779.1). MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDNM
Conjugation
Unconjugated
Family
Protease Non Catalytic
Subfamily
Threonine T1
Preparation and Storage
Store at -20 degree C. Avoid freeze-thaw cycles.

IHC (Immunohistochemistry)

(PSMA3 Antibody-Immunohistochemistry of paraffin-embedded rat lung using PSMA3 antibody at dilution of 1:200 (400x lens).)

product-image-AAA21304_IHC7.jpg IHC (Immunohistochemistry) (PSMA3 Antibody-Immunohistochemistry of paraffin-embedded rat lung using PSMA3 antibody at dilution of 1:200 (400x lens).)

IHC (Immunohistchemistry)

(PSMA3 Antibody-Human Colon: Formalin-Fixed, Paraffin-Embedded (FFPE))

product-image-AAA21304_IHC6.jpg IHC (Immunohistchemistry) (PSMA3 Antibody-Human Colon: Formalin-Fixed, Paraffin-Embedded (FFPE))

IHC (Immunohistochemistry)

(PSMA3 Antibody-Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE))

product-image-AAA21304_IHC5.jpg IHC (Immunohistochemistry) (PSMA3 Antibody-Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE))

WB (Western Blot)

(PSMA3 Antibody-Immunoprecipitation analysis of 200ug extracts of HL-60 cells, using 3 ug PSMA3 antibody. Western blot was performed from the immunoprecipitate using PSMA3 antibodyat a dilition of 1:1000.)

product-image-AAA21304_WB4.jpg WB (Western Blot) (PSMA3 Antibody-Immunoprecipitation analysis of 200ug extracts of HL-60 cells, using 3 ug PSMA3 antibody. Western blot was performed from the immunoprecipitate using PSMA3 antibodyat a dilition of 1:1000.)

WB (Western Blot)

(PSMA3 Antibody-Western blot analysis of extracts of various cell lines, using PSMA3 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking.)

product-image-AAA21304_WB3.jpg WB (Western Blot) (PSMA3 Antibody-Western blot analysis of extracts of various cell lines, using PSMA3 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking.)

ICC (Immunocytochemistry)

(PSMA3 Antibody-Immunofluorescence analysis of U2OS cells.)

product-image-AAA21304_ICC2.jpg ICC (Immunocytochemistry) (PSMA3 Antibody-Immunofluorescence analysis of U2OS cells.)

ICC (Immunocytochemistry)

(PSMA3 Antibody-Immunofluorescence analysis of MCF-7 cells using PSMA3 antibody. Blue: DAPI for nuclear staining.)

product-image-AAA21304_ICC.jpg ICC (Immunocytochemistry) (PSMA3 Antibody-Immunofluorescence analysis of MCF-7 cells using PSMA3 antibody. Blue: DAPI for nuclear staining.)
Related Product Information for anti-PSMA3 antibody
PSMA3 antibody is an unconjugated rabbit polyclonal antibody to PSMA3 from human. It is reactive with human and mouse. Validated for IF, IHC, IP and WB. Tested on 20 paraffin-embedded human tissues.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28,433 Da
NCBI Official Full Name
proteasome subunit alpha type-3 isoform 1
NCBI Official Synonym Full Names
proteasome (prosome, macropain) subunit, alpha type, 3
NCBI Official Symbol
PSMA3
NCBI Official Synonym Symbols
HC8; PSC3
NCBI Protein Information
proteasome subunit alpha type-3; macropain subunit C8; proteasome subunit C8; proteasome component C8; multicatalytic endopeptidase complex subunit C8
UniProt Protein Name
Proteasome subunit alpha type-3
UniProt Gene Name
PSMA3
UniProt Synonym Gene Names
HC8; PSC8
UniProt Entry Name
PSA3_HUMAN

Similar Products

Product Notes

The PSMA3 psma3 (Catalog #AAA21304) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PSMA3 Rabbit anti-Human Polyclonal Antibody reacts with Mouse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's PSMA3 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry-Paraffin (IHC-P), Immunoprecipitation (IP), Western Blot (WB). IF: 1:50-1:200 IHC: 1:50-1:200 IHC-P: 1:200 WB: 1:500-1:2000 The predicted MW is 27kDa/28kDa, while the observed MW by Western blot was 28kDa. Researchers should empirically determine the suitability of the PSMA3 psma3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PSMA3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.