Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-PSEN2 Polyclonal Antibody – Cat# AAA199418 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-PSEN2 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

Presenilin-2 Isoform 1 (PSEN2) Antibody – Rabbit Polyclonal

PSEN2 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
PSEN2; AD4; PS2; AD3L; STM2; CMD1V
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
PSEN2, Antibody; PSEN2 antibody - N-terminal region; anti-PSEN2 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VVVATIKSVRFYTEKNGQLIYTPFTEDTPSVGQRLLNSVLNTLIMISVIV
Sequence Length
448
Applicable Applications for anti-PSEN2 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PSEN2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-PSEN2 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

Rabbit Anti-PSEN2 Polyclonal Antibody – Cat# AAA199418 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-PSEN2 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

WB (Western Blot)

(WB Suggested Anti-PSEN2 AntibodyPositive Control: Lane 1: 80ug rat brain extract Lane 2: 80ug mouse brain extractPrimary Antibody Dilution : 1:500Secondary Antibody : IRDye 800 CW goat anti-rabbit from Li-COR BioscienceSecondry Antibody Dilution : 1:20,000Submitted by: Dr. Yuzhi Chen, University of Arkansas for Medical Science)

Rabbit Anti-PSEN2 Polyclonal Antibody – Cat# AAA199418 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-PSEN2 AntibodyPositive Control: Lane 1: 80ug rat brain extract Lane 2: 80ug mouse brain extractPrimary Antibody Dilution : 1:500Secondary Antibody : IRDye 800 CW goat anti-rabbit from Li-COR BioscienceSecondry Antibody Dilution : 1:20,000Submitted by: Dr. Yuzhi Chen, University of Arkansas for Medical Science)

IHC (Immunohiostchemistry)

(PSEN2 antibody - N-terminal regionFormalin Fixed Paraffin Embedded Tissue: Human Pineal TissueObserved Staining: Cytoplasm in Human Pineal TissuePrimary Antibody Concentration: 1:100Other Working Concentrations: 1/600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit Anti-PSEN2 Polyclonal Antibody – Cat# AAA199418 – IHC (Immunohiostchemistry) IHC (Immunohiostchemistry) (PSEN2 antibody - N-terminal regionFormalin Fixed Paraffin Embedded Tissue: Human Pineal TissueObserved Staining: Cytoplasm in Human Pineal TissuePrimary Antibody Concentration: 1:100Other Working Concentrations: 1/600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

IHC (Immunohistochemistry)

(Human kidney)

Rabbit Anti-PSEN2 Polyclonal Antibody – Cat# AAA199418 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Human kidney)
Related Product Information for anti-PSEN2 antibody
This is a rabbit polyclonal antibody against PSEN2. It was validated on Western Blot and immunohistochemistry

Target Description: Alzheimer's disease (AD) patients with an inherited form of the disease carry mutations in the presenilin proteins (PSEN1 or PSEN2) or the amyloid precursor protein (APP). These disease-linked mutations result in increased production of the longer form of amyloid-beta (main component of amyloid deposits found in AD brains). Presenilins are postulated to regulate APP processing through their effects on gamma-secretase, an enzyme that cleaves APP. Also, it is thought that the presenilins are involved in the cleavage of the Notch receptor such that, they either directly regulate gamma-secretase activity, or themselves act are protease enzymes.Alzheimer's disease (AD) patients with an inherited form of the disease carry mutations in the presenilin proteins (PSEN1; PSEN2) or the amyloid precursor protein (APP). These disease-linked mutations result in increased production of the longer form of amyloid-beta (main component of amyloid deposits found in AD brains). Presenilins are postulated to regulate APP processing through their effects on gamma-secretase, an enzyme that cleaves APP. Also, it is thought that the presenilins are involved in the cleavage of the Notch receptor, such that that they either directly regulate gamma-secretase activity or themselves are protease enzymes. Two alternative transcripts of PSEN2 have been identified.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49kDa
NCBI Official Full Name
presenilin-2 isoform 1
NCBI Official Synonym Full Names
presenilin 2
NCBI Official Symbol
PSEN2
NCBI Official Synonym Symbols
AD4; PS2; AD3L; STM2; CMD1V
NCBI Protein Information
presenilin-2
UniProt Protein Name
Presenilin-2
UniProt Gene Name
PSEN2
UniProt Synonym Gene Names
AD4; PS2; PSNL2; STM2; PS-2
UniProt Entry Name
PSN2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The PSEN2 psen2 (Catalog #AAA199418) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PSEN2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PSEN2 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the PSEN2 psen2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VVVATIKSVR FYTEKNGQLI YTPFTEDTPS VGQRLLNSVL NTLIMISVIV. It is sometimes possible for the material contained within the vial of "PSEN2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.